SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005672 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005672
Domain Number 1 Region: 22-71
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 1.02e-18
Family Cysteine-rich DNA binding domain, (DM domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 238-283
Classification Level Classification E-value
Superfamily UBA-like 0.000000209
Family CUE domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005672   Gene: ENSTGUG00000005521   Transcript: ENSTGUT00000005730
Sequence length 467
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:65330746:65338806:-1 gene:ENSTGUG00000005521 transcript:ENSTGUT00000005730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYVSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCKKCIL
IIERQRVMAAQVALRRQQANESLESLLPDSLRSLPGPPGNAEPPAPPPGPSTCAVPPRTP
AELAAATALRWDTEPTPALPGPHPKADVNEERLGDASGADSAETYSDKDTDQRSSPDMTK
TKSCFNPESPEIVSVDEVGFAVQKNGGGTENRPDSPKYHPEQNHLLIEGPSGTVSLPFSL
KANRPPLEVLKKIFPNQKPAVLELILKGCGGDLVSAVEVLLSSRSSVASGERSSAESDGL
VLPSNGHIFEHTLSSYPISSSKWSVGSAFRVPDTLRFSADSSNVVPNPLAVPLQHPFPQP
PRYPLMLRNTLARNQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFSSSSATVFRSSPVL
PSRSSEDPRISIPDDGCPIVSKQPIYTEDEYEDRSDSSDSRILNTSS
Download sequence
Identical sequences H0Z526
ENSTGUP00000005672 59729.ENSTGUP00000005672 ENSTGUP00000005672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]