SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005892 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005892
Domain Number 1 Region: 122-324
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-52
Family DBL homology domain (DH-domain) 0.00000124
Further Details:      
 
Domain Number 2 Region: 311-473
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-33
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 3 Region: 590-691,768-794
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-24
Family SH2 domain 0.00082
Further Details:      
 
Domain Number 4 Region: 716-796
Classification Level Classification E-value
Superfamily SH3-domain 3.13e-20
Family SH3-domain 0.0008
Further Details:      
 
Domain Number 5 Region: 1-147
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000219
Family Calponin-homology domain, CH-domain 0.034
Further Details:      
 
Domain Number 6 Region: 503-583
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000971
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005892   Gene: ENSTGUG00000005682   Transcript: ENSTGUT00000005951
Sequence length 800
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:7916837:8029307:-1 gene:ENSTGUG00000005682 transcript:ENSTGUT00000005951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFLCLKNIRTFLKVCHDKFGLRNSDLFDPFDLFDVRDFGKVISAVSRLSFHSIAQTKGIR
PFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIRVEVQQPMKMG
MTEDDKRNCCLLEIQETEAKYYKTLEDIEKNYMNPLRLVLTPQDMEAIFINLEDLIKVHF
SFLRAIDVSMMSGGSSLAKVFLEFKERLLIYGKYCSHMEYAQNTLNHLLASREDVRQKVE
ECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSSDRPEKQQLKEALEAMQDLAMY
INEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDK
VVIVCKRKGYNYELKEIIELLFHKMTDDPMNNKDIKKWSYGFYLIHLQGKQGFQFFCKTE
EMKRKWMEQFEMAMSNIKPEKANANHHNFQMYTFEKTTNCKACRMFLRGTFYQGYLCPKC
GAGAHKECLEIIPPCKMGSWSFSLAGSFLGPKMVAVQNYHGNPAPPGKPVLTFQIGDVME
LLRGDPDSPWWEGRLLQTKKSGYFPSSSVKPCPVDARPPNSRPPSREIDYTAYPWFAGNM
ERHQTDNLLKSHVSGTYLIRERPAEAERFAISIKFNEEVKHIKVVEKDNWIHITEAKKFE
SLLELVEYYQSHSLKESFKQLDTTLKYPYKSRERSTSRTFTRSPASCASYNFSFLSPQGL
NFSSQSSSSPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKG
ETNGRVGWFPSTYVEEEGVQ
Download sequence
Identical sequences H0Z5P6
59729.ENSTGUP00000005892 ENSTGUP00000005892 ENSTGUP00000005892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]