SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006342 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006342
Domain Number 1 Region: 1616-1860
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.26e-54
Family Ankyrin repeat 0.000000058
Further Details:      
 
Domain Number 2 Region: 611-741
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000235
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 724-855
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000565
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 4 Region: 154-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000129
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 924-1066
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000146
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 269-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 508-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000136
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 8 Region: 382-511
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 545-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000157
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 895-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000118
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 11 Region: 48-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000503
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 12 Region: 586-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000146
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1283-1315
Classification Level Classification E-value
Superfamily Notch domain 0.00000012
Family Notch domain 0.0036
Further Details:      
 
Domain Number 14 Region: 1243-1276
Classification Level Classification E-value
Superfamily Notch domain 0.000000131
Family Notch domain 0.0043
Further Details:      
 
Domain Number 15 Region: 1062-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000152
Family EGF-type module 0.015
Further Details:      
 
Domain Number 16 Region: 1202-1234
Classification Level Classification E-value
Superfamily Notch domain 0.000000248
Family Notch domain 0.0006
Further Details:      
 
Domain Number 17 Region: 1143-1182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000249
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 18 Region: 867-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000108
Family EGF-type module 0.023
Further Details:      
 
Domain Number 19 Region: 1103-1140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.018
Further Details:      
 
Domain Number 20 Region: 7-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000292
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006342
Domain Number - Region: 91-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00046
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006342   Gene: ENSTGUG00000006073   Transcript: ENSTGUT00000006406
Sequence length 2274
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:8964363:8983929:1 gene:ENSTGUG00000006073 transcript:ENSTGUT00000006406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFTGQNCEENINDCPGNNCKNGGTCVDGVNTYNCQCPPECTGSARTADVNECNISPPICK
NGGSCTNEVGTYQCSCKPAYTGQNCEHLYVPCNPSPCQNGGTCRQIGDTTYDCTCLPGTG
QHLQSTPNEECLNFPQQKGLSCSTLHLCGRSICTCLSGYMGPGNQDVDECSLGANPCEHA
GKCINTQGSFQCQCLQGYSGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGVY
CEINTDECASSPCLHNGNCLDKINEFHCECPTGFNGHLCQFDIDECASTPCKNGAKCVDG
PNTYSCECTEGFTGAHCEIDIDECDPDPCHYGTCKDGIASFTCLCQPGYTGHRCDININE
CQSQPCKNGGTCQDRNNAYNCICLKGTTGPNCEINLDDCASNPCDYGKCIDKINGYECTC
EPGYTGRMCNINIDECASNPCHNGGTCKDGINGFTCLCPEGFHDPKCLSEVNECNSNPCI
HGKCHDGLNGYKCDCDPGWSGTNCDINNNECESNPCMNGGTCKDMTSGYICTCREGFSGP
NCQTNINECASNPCLNQGTCIDDVAGYTCNCLLPYTGATCEDVLAPCAGSPCKNGGECQE
SEDYKSFSCSCPPGWQGQTCEIDINECVKSPCRNGATCQNTNGSYRCACRTGFSGRNCDT
DIDDCKPNPCHNGGSCSDGIGTFFCECLAGFRGPKCEEDINECASNPCKNGANCTDCVNS
YTCTCPSGFSGIHCENNTPDCTESSCFNGGTCVDGINTFTCVCLPGFTGSYCEHNINECD
SKPCLNGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTSNLYHCECN
SGWTGLYCDVPSVSCEVAAKQQGIDVAHLCRNSGLCVDTGNTHFCRCQAGYTGSYCEEQV
DECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCQNGGTCIDLINTYK
CSCPRGTQGVHCEINVDDCSPFFDPVTLGPKCFNNGKCKDRVGGYSCICPPGFVGERCEG
DVNECLSNPCDARGTQNCVQRVNDYKCECRPGYAGRRCDTVVDGCKGKPCRNGGTCAVAS
NTGRGFICKCPPGFVGATCENDSRTCGNLHCLNGGTCISIHKSSKCMCTPAFTGPECQYP
ASSPCTSNPCYNGGTCEFSSDASPFYRCNCPANFNGLNCHILDFDFQGGIGQDIIPPKIE
EKCEIAVCAGYAGNKICDGKCNNHACGWDGGDCSLNFNDPWKNCSQSLQCWKYFNDGKCD
SQCNNAGCLYDGFDCQKYEGQCNPLYDQYCKDHFSDGHCDQGCNNFECEWDGLDCANNMP
EKLADGTLVVVVLITPENLKNNSFNFLRELSRVLHTNVVFKKNPKGEYMIFPYYGNEEEL
KKHYIKRSTEDWSDISLYSRAGRRQKRELDQMDIRGSIVYLEIDNRQCIQSSSQCFQSAT
DVAAFLGALASLGNLNIPYKIEAVKSETAEPTKNSQLYPMYVVGAALVLLAFIGLGVLVN
RKRRREHGQLWFPEGFKVTESSKKKRREPLGEDSVGLKPLKNASDGTLMDDNQNEWGDEE
TLDTKKFRFEEQAMLPDTDDQTDHRQWTQQHLDAADLRISSMAPTPPQGEIDADCMDVNV
RGPDGFTPLMIASCSGGGLETGNSEEEDDAPAVISDFIYQGASLHNQTDRTGETALHLAA
RYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGT
TPLILAARLAVEGMLDDLINCHADVNAVDDLGKSALHWAAAVNNVEAAMVLLKNGANKDM
QNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEY
NLVRSPTLHNGPLGAPTLSPPLCSPNSYIGNLKPAVQGKKARKPSTKGLSCNGKDAKDLK
ARRKKSQDGKGCLLDNSGVLSPVDSLQSPSMPLNHLPGMPDAHLSINHLNLAGKQDMAMG
SSSRMGFDSVPPRLSHLPVSSPSTGMSSAPMSFSVGSGASLNGQCDWLSRLQNGMVQSQY
NPLRGNLQPGAHQQPQNLQHGMMTSLHNGLPTTSLSQMMSYQAMPNTRLASQPHLMQSQQ
LQQMQQQQQQQQQQLQQPNLQPPQQPQPPPPQQPQQPQQHHNPSGSNLGQNFLGTELSQP
ELQPVSGSAMAVHTILPQDSQMLPTSLPSSLAQPMTTTQFLTPPSQHSYSSPLDNTPSHQ
LQVPDHPFLTPSPESPDQWSSSSPHSNVSDWSEGISSPPTSMQSQMGHIPEAFK
Download sequence
Identical sequences H0Z6Z3
59729.ENSTGUP00000006342 ENSTGUP00000006342 ENSTGUP00000006342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]