SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006895 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006895
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 5.36e-65
Family TRADD, N-terminal domain 0.0000053
Further Details:      
 
Domain Number 2 Region: 206-300
Classification Level Classification E-value
Superfamily DEATH domain 3.18e-16
Family DEATH domain, DD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006895   Gene: ENSTGUG00000006714   Transcript: ENSTGUT00000006964
Sequence length 307
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:6498110:6503633:-1 gene:ENSTGUG00000006714 transcript:ENSTGUT00000006964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAGSSPPWTGSAYLFLQSTCKTIALPSLYESSQKKPCVFKALKLALADSTGSVNGVDML
KVHCSHPHLIVQLRFCKEENCRRFLQSYREGALQKSLQSHLQLCLATTMVPLELELKAGS
EHLDKMLKDEDRCLECIFREKPDRLPDEEIMELEERLKSLKLHQSTNNNVAGKDCSSLKS
PSQPYPPQGSSLPIQLTFIFQGQQFDNRAITPDDHQKFAKSVSKKWKQVGRSLQKSCRAL
RDPVIDNLALEYDREGLYEQAYQMLLRFIQSEGKKATIARLIAALEENGLVSLAEELLGL
HSTEDCS
Download sequence
Identical sequences H0Z8J2
ENSTGUP00000006895 ENSTGUP00000006895 59729.ENSTGUP00000006895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]