SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007218 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007218
Domain Number 1 Region: 549-753
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-24
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 2 Region: 331-536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-24
Family Laminin G-like module 0.0095
Further Details:      
 
Domain Number 3 Region: 774-966
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.91e-22
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 3-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000282
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 1148-1189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000439
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 6 Region: 168-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000636
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 7 Region: 129-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000607
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 8 Region: 1065-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000765
Family EGF-type module 0.029
Further Details:      
 
Domain Number 9 Region: 991-1032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000171
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 10 Region: 1027-1069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 11 Region: 1113-1152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000247
Family EGF-type module 0.019
Further Details:      
 
Domain Number 12 Region: 264-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000605
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 206-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000007218
Domain Number - Region: 792-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.002
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007218   Gene: ENSTGUG00000007009   Transcript: ENSTGUT00000007289
Sequence length 1255
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:10198901:10221157:1 gene:ENSTGUG00000007009 transcript:ENSTGUT00000007289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLCRPGFSGATCGHDIDECASGPCRNGAICRDSAGEYSCFCVPGFQGSHCEIDIDECASR
PCRNQGTCLNHMDRYECRCAPGYAGVNCDTEIDECASDPCQNGALCNDHVGFYTCTCAPG
YQGAQCEVDINECESQPCQSNGTCHDLINSYHCDCSDTGFEGTHCELDILECASDPCHNS
ATCLEGIKGYSCVCWPGYTGQECEEDMDECVTEPCHNGGLCLERSNPAHYGTQPHFPSNF
SYSQAAGFLCQCQPGFTGVECAVNINECEEGPCKNGAVCEDGIADYSCHCAPAQDGIMWG
GKNCSVQLTGCQTHDCQNEALCIPTYQAESHGHLCQCQPGFSDATCSTPTTFSFASRGHL
LIELPENSASGRDAGGASVSLRFRTTLPSAVLFYRGREAEYLFLELLDGILHAELKREDV
GYPLLLKGLRVVDGQWHKWEVVVHSTVQLKLWHGSCEAGVCLQSSPVPPGTAVIPQAFLN
LYIGGAEHPMANNTRSQQGFVGCLEDLQVDAEAVLPADLPLGESSPARPGCDRTEWCLSR
PCFHGGLCVDLWATFRCDCARPYGGPACSYERPAATFGLENSTSFASFTLSDSFGADFNL
SFFLRSRKPDGLLLQVCNGTGPCLTLYLRDGQLSIEMSPTDTVTFPGNVVDGRRHLIALS
FQGGSVGALQSDSFVELGQLPAQALGAGSEVFIGGHPNPGSAELWGGYFKGCLQDIQLNN
HQIQFFQVENDSLPEELNRTQTGNLVNGCISDDTCKSEPCQNGGRCIVTWNDFHCSCPAN
FTGKFCEEKVWCESDPCPEATTCIDVVAGYVCLANATFNSYAAVEFTTSTSVTRTLSSLH
MDFRTRDEDAVLLQAVEEVDSLQVAIKNSSLLVDIRTGNGIEGVSFLSPQPVTDGAWHSV
SVSMEEPAALSSRWLLRLDGAVNVTLQGSAGSLDFLKNNVSVVLAENFTGCLGRVQIGGI
FLPFPPHQPYPQAEQFQRASPGSVQLGCSGADVCASSPCLNAATCEDLFNAFRCGCSAGW
AGQRCEANIDDCQPSPCVHGACVDAVADFQCECFRGFIGKRCDINVDDCVRHQCLNGATC
IDGVYGYSCKCPPQYSGPRCDYLVLALSFLGPSCTNFTCLNGGRCITESWGANCSCRPGF
TGRNCQININECDPNPCQNGGTCQDSENRYECVCSASYTGERCDINMLDFGHSSVVGAVG
AAGAALLLALVIATAIAMKRRRATQGTYSPSRQEKDGARVEMWNVIKMPPTERLI
Download sequence
Identical sequences H0Z9G5
ENSTGUP00000007218 59729.ENSTGUP00000007218 ENSTGUP00000007218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]