SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007439 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007439
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2190-2306
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-37
Family Pleckstrin-homology domain (PH domain) 0.00000304
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 603-742
Classification Level Classification E-value
Superfamily Spectrin repeat 9.48e-33
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 5 Region: 1010-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-30
Family Spectrin repeat 0.0000235
Further Details:      
 
Domain Number 6 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 2.82e-28
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 7 Region: 1858-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 1.71e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 1454-1589
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-26
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 9 Region: 738-855
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-24
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 10 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 1698-1803
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 1594-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-22
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 13 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 14 Region: 850-951
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-18
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 15 Region: 1384-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 7.49e-18
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 16 Region: 1993-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000183
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007439   Gene: ENSTGUG00000007183   Transcript: ENSTGUT00000007514
Sequence length 2360
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:28582365:28664055:-1 gene:ENSTGUG00000007183 transcript:ENSTGUT00000007514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVAKELETENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQI
LSSDDYGKDLTSVVRLLSKHKAFEDEMSGRSGHFQQAIKEGEDMIAEEHFGSEKIRERIK
DIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ
SLVKKHKDVAEEIASYRPTIDSLHEQAKALPQEHAESPDVQGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEKWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPGEKIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYH
LECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEK
LESEHPDQAQAILSRLAEINDVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRT
QTAIASEDMPNTLTEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLR
QRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQASYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDDRHRKN
REAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLEKIEKEGMQLIAEKPETEAVVKEKLTGLHQMWDELESTTQTKAQRLFDAN
KAELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEIEELQ
SQARALSQEGKSTDEVDGKRLTVEKKFLELLEPLNERKANLLASKEIHQFNRDVEDEILW
VGERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITESSPNAE
VIQQRLADLKQLWNLLIEETEKRHKRLEESHRAQQYYFDAAEAEAWMSEQELYMMSEEKA
KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRTLVADNHPESERISMRQSKVDKLYA
GLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR
EFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQIL
AASYELHKFYHDAKEILGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVR
QLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMVR
DLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARK
HYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLS
SREIGQSVDEVEKLIKRHEAFEKSAATWDERFAALERLTTLELLEVRRQQEEEERKRQPP
TPEPKVAEDGDSQQQWDGTKGEQVSQNGLPSDQESPRVAETAETNEMVNGAAEQRTSSKE
SSPIPSPTSDRKAKSGVQAQTAATLPAKTQEIPSAQMEGFLHRKHEWETHSKKASSRSWH
NVYCVINNQEMGFYKDSKAAASGIPYHNEIPVSLKDAVCEVAVDYKKKKHVFKLRLTDGN
EYLFQAKDDEEMNTWIQAITSAISSDKIEVSPTTQSTPASSRAQTLPASVTITSESSPGK
REKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences H0ZA36
59729.ENSTGUP00000007439 ENSTGUP00000007439 ENSTGUP00000007439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]