SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007852 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007852
Domain Number 1 Region: 94-212
Classification Level Classification E-value
Superfamily PX domain 8.94e-16
Family PX domain 0.0031
Further Details:      
 
Domain Number 2 Region: 292-346
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 890-921
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000082
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007852   Gene: ENSTGUG00000007612   Transcript: ENSTGUT00000007937
Sequence length 945
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:10578765:10626238:-1 gene:ENSTGUG00000007612 transcript:ENSTGUT00000007937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSLMASTSKNPSTSALNTMATYPGCHKVTPRSETPIN
SVSNSLENVLHTSTHSMEESLPKRPSGKHSKVSVEKVELKGLAHKKNERNVEYSFEVLWS
DSSVTLVTKSSAEVTEFISKLSQLYPEENLEKFIPCLAGPDSFYLERNHMDLESDLRYLA
PFPSHVVKNDHVRKFFSTSSPSQQLQSSSPGNPSLYKVGTTLGTSGRPICGVAGIQSSQN
HVQHSAAAPVSLPHCSHSGGAGSSLGYRSQLENSSPAMLMSSSPQTPQTQEQNGILDWLR
KLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCLNPS
TPSSVTSSGVARVPPTSHVGPIQSIRGNHAAELRVDVDQPAHPLPREGSSSEYSSSSSSP
MGIQTREESSDSAEENERRLELHLDASDKEKPVMLLNHFPSSSARPTAQVLPVQNEAGSG
PAGHHALPMQMLSPSPSHMAPIRMLGSVHKPERGSADMKLLSSSVHSLLSLEERNKASPG
SRGSIKMEKGFGNAVVDVMSASSPHQPLQVLSGGAESSSPTSTMNFGPRTKVVHASTLDR
VIKPAQQPGLIVETSTAATVTSSTVFHVARPPIKLLVSSSLPTDSAMAGQTSCSSNMQIT
VSPAIINPRTALYTANTKVAFSAMSSVPVAPMQGSFCANSNAASSSSHPSPSFTTMANLP
SCPAPSSSPTLSSGADNNFYSSSSSSSSSNSGGGSAGSVPVPNQNHHHHHHQQPPPQPPG
CMVCSSCGCSGNCGSSGMTVSYANYFQHPFSGPSMFTFPFLPFNPLCSNGYINTQQYNSS
TTFPVVHTAYNSGLAPDSVMAGQSTFAVPPMQNFMAGTAGVYQAQGMMGNGNGSSHKKNG
NLSCYNCGASGHRAQDCKQPPMDFNRQGTFRLKYAPPSESLDSTD
Download sequence
Identical sequences H0ZB94
XP_002194751.1.42559 ENSTGUP00000007852 59729.ENSTGUP00000007852 ENSTGUP00000007852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]