SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008071 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008071
Domain Number 1 Region: 1285-1364
Classification Level Classification E-value
Superfamily Immunoglobulin 3.44e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 901-974
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000143
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 1189-1266
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000583
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 684-736
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000798
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 397-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000051
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 452-512
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000471
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 549-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000051
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 8 Region: 791-857
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000536
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 9 Region: 1407-1464
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000876
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 10 Region: 739-796
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000129
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 11 Region: 53-101
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000366
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 12 Region: 1458-1521
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000114
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 13 Region: 1584-1640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 14 Region: 319-379
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000824
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 626-681
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008071   Gene: ENSTGUG00000007800   Transcript: ENSTGUT00000008156
Sequence length 1676
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:11361856:11503291:1 gene:ENSTGUG00000007800 transcript:ENSTGUT00000008156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTRAEQSQGAYFLPEFALSPQGSFLEDTTGEQFLTYRYDDQNSRTTRSDEDKDDSWDAWG
AWSDCSRTCGGGASYSLRRCLNGRNCEGRNIRYKTCSSNDCPSDVGDFRAQQCSAYNDVK
YQGHFYEWVPVYNDPTAPCALKCQALGKNLVVELAPKVLDGTRCNTESLDMCISGICQAV
GCDRQLGSNAKEDNCGICAGDGSTCRLVRGQAKAHVSPEKREETVIAVPHGSRSVRITLK
GPAHLVIESKTLQGEKGEHSFNAPGTFVIENTTVEFQKSTDREIMKIQGPLGADFIVKTR
YSGSKESVVQFFFYQPISHQWRQTEFFPCTVTCGGGYQLNSAECVDIRLKRVVPDHYCHY
HPENKKPKPKLKECNMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRS
FVCVEETIHGEILQVEEWKCMYAPKPKVIQTCNLFDCPKWVAMEWSQCTVTCGRGLRYRV
VLCIDHRGQHVGGCNPQLKLHIKEECIVPIPCYKPKEKSPVEAKLPWFKQAHEMEETITV
SEEPTFIPEPWSPCSATCGSGIQVRDVKCRILLAFTQTEVELPEEECEDERPPTERVCHQ
ASCDSDPVPYTPEFPHAEDGSVIYDWEYIGFTPCSATCLGGTQEAIAMCLHVDTKQGVSE
TLCDNSKRPPPMTRTCNTKLCPPRWQSGPWSRCSASCGVGIQSRAVSCQQPGHAAPTAQC
TEPKPHSLQACNQIDCPPAWHAEEWQQCSRTCGGGIQTRRVSCKQLLTDGSFLKHPDDTC
QEPKLPTSKACAKVDCPPQLVFGEWSKCSVSCGVGIQRRKLACQNLTAKGQYVPLNGSMC
SALSPSLLVRSCQMTACNKIKPKLPGKFSAHGPQIVSIHRVYIQTRPEKRINFTIGSRAY
LLPKTSVVIKCPVRRFQKSLIRWEKDGQHLQNSKRLGITKSGSLKIHCLEAGDIGVYRCI
AGSVHETFVLKLIGTDNRLIEPPPPRKQPSETSDPDHNEANSLGAKWHKMSKMWQMWSKK
NELYLGDRQVNDQPFLRSRGSFGGNSAEDFSSREFRNKRLEAAALQGAYSMDTAQFEELM
RNMSQLIETGEVSDDLASQLIYHLIAELSRHPQSAAEKWKGAQDEKVSSKLPSKSPNESE
RFSSKTVDKLMFDQKVPVIIRQKEIPQVSFNKTVTVRIGNTVFLTKNTHAVNLLCETAGM
SEVKYTWTKDGETLKASAKVILETTGKVQIRNPTQKELGTYGCLVVNDSGFDMETSLLLR
AEVPVIFSSVLNMTNLEASSFSTVVGSTIVARTGANILIECPVKGIPKPNVTWLKKKDVL
QINSSLVLNGSLFLKNVSYGDAGTYTCRATNALGKAEAASVLHITEQRLTENNTQLLKGS
RRKRVLMASGTGTNVSVAPGDPLRIGYTWEYAEWSPCSATCGHSGTRSRSLQCTNTEKQK
VNESQCRELQKPGIVYQPCNREDCPPRWVAGPWSECSASCGSGFRHRQLSCHQATANGSA
LALLPGACTARERPAARKPCPGQPLVKFTECTECSGRCVGRPAGSQHREFICQLRNGSSV
PNSSCDERKSPPARRNCSSEGCDVYWRPGPWRPCSVGCGSGFQSRPVSCVHRQSSKPVAE
QFCRGRKRPATWQHCSVTSCGSECKDTTHYCTFVKQLKLCLIDTYKQRCCQSCQEM
Download sequence
Identical sequences H0ZBW3
ENSTGUP00000008071 ENSTGUP00000008071 59729.ENSTGUP00000008071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]