SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008559 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008559
Domain Number 1 Region: 769-877
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-24
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 280-400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 4-132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000152
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 242-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000112
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 131-278
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008559   Gene: ENSTGUG00000008276   Transcript: ENSTGUT00000008650
Sequence length 955
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:9044859:9078806:1 gene:ENSTGUG00000008276 transcript:ENSTGUT00000008650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECALGLDDCHPDAICQNTPKLYKCMCKMGYTGEGRKCEDIDECDNDFNGGCVHECFN
IPGNYRCTCYDGFMLAHDGHNCLDTDECIFNNGGCQHLCVNTVGSYECRCKEGFFLSDNQ
HTCIHRSEEGMSCMNKDHGCAHICRETPKGGVACECRPGFELSKNQRSCILTCNHGNGGC
QHTCDDADHGPVCGCHPKYVMHVDGKTCLESEEAAVEVSEGNTTAAADVDKRVKRRLLME
TCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQFDGKTCKDIDECQSNNGGCDHFCKNTVGS
FDCSCRKGFKLLTDEKSCQDVDECSFERACDHTCINHPGTFECTCNRGYALYGFTHCADI
NECSINNGGCQQLCVNTLGDYECLCQSNYKLHWNKKDCVETKDPLSDNASPKVLLHCIKS
GGSDRCFLSCSPDVQVFSDASAIKISVTFKLNEGKCSLRKTEIFQEGLEQMIPERQNSVM
ESFHYVNLTCSSGKKVHGALSRLAATREIFITADFELEMSRKEVTDTCDVRCARKKTEKR
FRKTIRTLRKTVSRDQFRIRLSGTEHEVARKALKPSEPQQSCGVGQLHPGLRCGESRAGC
AKVGSRTRACCTALQLMHSLTGQAECPVVYFPVHTGGIKLQLAVSLWGCGSYQCSPGEYS
PDGFKPCLPCPLGTYQPEAGRVSCFPCGGGLTTRHSGASLFQDCETKVQCSPGHFYNTTT
HRCIRCAIGTYQPEFGQNYCISCPGNTTTDFDGSTNITQCKNRQCGGELGDYTGYIESPN
YPGDYPANTECTWNINPPPKRRILIVVPEIFLPIEDECGDYLVMRKSSSSNSVTTYETCQ
TYERPIAFTSRSKKLWIQFKSNEGNSAKGFQVPYVTYDEDYQELIEDIVRDGRLYASENH
QEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences H0ZD98
ENSTGUP00000008559 59729.ENSTGUP00000008559 ENSTGUP00000008559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]