SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009030 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009030
Domain Number 1 Region: 6-252
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.96e-49
Family Galactose oxidase, central domain 0.012
Further Details:      
 
Domain Number 2 Region: 234-332
Classification Level Classification E-value
Superfamily Kelch motif 9.55e-20
Family Kelch motif 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009030   Gene: ENSTGUG00000008764   Transcript: ENSTGUT00000009127
Sequence length 345
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:12138290:12141517:-1 gene:ENSTGUG00000008764 transcript:ENSTGUT00000009127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAWATFPAMPTRRVYCSAAHRDGQLFVLGGCGGGGRALGTAEVLDLQAQRWTTLPPLPTP
RAGAAVLTLGKQILVVGGVDAAQSPLASVEVYHVDEGKWEKKAALAQPSMGISAVQRDGV
VYALGGMGADTSPQALVRVYEPAKDHWQPLPSMPTPCYGASAFLQGNKIFVLGGRQGKLP
VTAFEAFDLETRSWTRYPSVPSRRAFAACAMADGVVFSLGGLQQPGPHNFYSRPHFVNTV
EMFDPAQGVWRKPSRTIRMKEKRADFVAGCLGGRVVAVGGLGNQSCPLDSVEGFSLSQKK
WEPLPPMPTGRCSCSSCPTPSLLFIIGGVAQGPSGAVEALCLRDV
Download sequence
Identical sequences H0ZEL8
59729.ENSTGUP00000009030 ENSTGUP00000009030 ENSTGUP00000009030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]