SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009062 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009062
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily UBC-like 9.91e-49
Family UBC-related 0.000000494
Further Details:      
 
Domain Number 2 Region: 137-178
Classification Level Classification E-value
Superfamily UBA-like 1.13e-22
Family UBA domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009062   Gene: ENSTGUG00000008793   Transcript: ENSTGUT00000009159
Sequence length 180
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:48012690:48032933:-1 gene:ENSTGUG00000008793 transcript:ENSTGUT00000009159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIW
HPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEM
FKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
Download sequence
Identical sequences H0ZEQ0
ENSTGUP00000009062 59729.ENSTGUP00000009062 ENSTGUP00000009062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]