SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009352 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009352
Domain Number 1 Region: 49-81
Classification Level Classification E-value
Superfamily UBA-like 0.0000034
Family UBA domain 0.032
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009352
Domain Number - Region: 14-47
Classification Level Classification E-value
Superfamily UBA-like 0.000451
Family UBA domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009352   Gene: ENSTGUG00000009079   Transcript: ENSTGUT00000009451
Sequence length 83
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:18350484:18351607:1 gene:ENSTGUG00000009079 transcript:ENSTGUT00000009451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVCLPLQFLSYLGACDRLLKQGYEEGQVEEAMEMFQYSEKKAAEFLYLLAQFNDMGFQQN
EVKEVLLLCGNQSERALEELVMK
Download sequence
Identical sequences H0ZFJ0
59729.ENSTGUP00000009352 ENSTGUP00000009352 ENSTGUP00000009352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]