SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009379 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009379
Domain Number 1 Region: 861-1041
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-45
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 1016-1135
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0048
Further Details:      
 
Domain Number 3 Region: 170-193,248-375
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 15-157
Classification Level Classification E-value
Superfamily PH domain-like 8.88e-18
Family Phosphotyrosine-binding domain (PTB) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009379   Gene: ENSTGUG00000009056   Transcript: ENSTGUT00000009478
Sequence length 1235
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:48579775:48683197:-1 gene:ENSTGUG00000009056 transcript:ENSTGUT00000009478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFKVKKCLTPSDFSASFSLQLVGSLPVHSLTTMSMLPWIVAEIQLLSAKSSKEEPS
VSQIRLCVSPASLRCEPDTGETQQWDPLICSSLFEYKPQQVHKLIHNSHDPSYFACLIKD
EAANQQSICYVFKADDQTKVPEIISSIRQAGKIARQEEFQNNLSDVEDPFAKKFEVLFCG
RVTVAHKNAPPALIDECIEKFNRASCTKSSDFNSSSQQHENANNPIRKSFSQPGLRSFAF
KKDFQEGSLRSNSFVRSFEEDAISLNLKSQLIYGHSVVQPTDIAENRTMLFTIGQSEVYL
ISPDTKKVAIEKSFKEISFCSQGIRHVDHFGFICRESSENGGFHFVCYVFQCTDEALVDE
IMMTLKQAFTVAAVQQTSKAQPQLCEGCPMQSLHKLCEKIEGLHPSKTKLELQKHLTTLN
NQEQASVFEEVQKLRPRNEQKENELVISLLRNMYEEKQKDHVHVGEAKQASQPPAENAVN
EVSSSAPRFRLDMLKNKAKRSLTESFESILSRGSKARGPLDRSGSVDLDSSVSSTLSSTN
KKMSVGYRLPTLPAENAVKTSGSLDDLCSDTEDFSLEQSVTLPQQSFRRRANTLSHLPTE
NQESLGPVETSPSVPQRKLMRYHSVSTETPHKRNVSLLGGFSSGQLARSPTLARLNPSAS
SPNFLKYLRHNSSGEPSGHFAQKSISYRTALRKKLHSSSSVPNFLKFLAPVDENNTSDFR
STTSDYESKHGQQALDADSPVRTRRHSWRQQIFLRVATPQKACDSPSRYDDYCELGDLPP
RSPLEPVCEDGPFGPVKEERKRTPHELRELWKKAIIQQILLLRMEKENQKLQASENNLQN
RRLKLDYEEITPCLKDVTLIWEKMLSTPGRSKIKFDVEKIHSAVGQGVPRHHRGEIWKFL
AEQYHLKHQFASKQQPKETPYKELLKQLTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSL
YNILKAYSLLDQEVGYCQGLSFVAGVLLLHMSEEDAFKMLTFLMFDMGLRKQYRPDMTIL
QIQMYQLSRLLHDYHRDLYNHLEAHEIGPSLYAAPWFLTMFASQFPLGFVSRVFDMLFLQ
GSEAIFKVALSLLGSHKPLILQHENLETIVDFIKSTLPNLGLVQMEKTISQVFEMDIAKQ
LQAYEVEYHVLQDELIDSSLNDNQRLDKLEKANSSLRKQNFDLLEELQVANGKIQNLEAT
VEVLLANESKLKQSILTLEQERAALLKAVEEMQKK
Download sequence
Identical sequences H0ZFL7
ENSTGUP00000009379 ENSTGUP00000009379 59729.ENSTGUP00000009379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]