SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010134 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010134
Domain Number 1 Region: 447-605,685-816
Classification Level Classification E-value
Superfamily L domain-like 5.39e-56
Family Ngr ectodomain-like 0.00059
Further Details:      
 
Domain Number 2 Region: 215-421
Classification Level Classification E-value
Superfamily L domain-like 3.74e-43
Family Ngr ectodomain-like 0.00034
Further Details:      
 
Domain Number 3 Region: 2-200
Classification Level Classification E-value
Superfamily L domain-like 4.59e-43
Family Ngr ectodomain-like 0.00091
Further Details:      
 
Domain Number 4 Region: 1075-1236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.33e-32
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 5 Region: 1007-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000628
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 930-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000568
Family EGF-type module 0.023
Further Details:      
 
Domain Number 7 Region: 890-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 8 Region: 969-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000397
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010134   Gene: ENSTGUG00000009734   Transcript: ENSTGUT00000010241
Sequence length 1236
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:21600422:21644695:1 gene:ENSTGUG00000009734 transcript:ENSTGUT00000010241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELNGNNITRINKNDFAGLKQLRVLQLMENQISVVERGAFDDMKELERLRLNRNQLHTLPE
LLFQNNQALSRLDLSENFIQAIPRKAFRGATDLKNLQLDKNQISCIEDGAFRALRGLEVL
TLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFTQCAAPA
QLRGLNVAEIQKNEFSCSGQTDSAHAQLCSLSSGSCPAMCTCSNGIVDCRGKGLTAIPAN
LPETMTEIRLELNGIKSIPPGAFSPYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYG
NKITDLPKGVFGGLFSLQLLLLNANKINCVRADAFQDLQNLSLLSLYDNKIQSLAKGTFT
SLRAIQTLHLAQNPFICDCNLKWLADFLRANPVETSGARCASPRRLANKRIGQIKSKKFR
CSAKEQYFIPGTEDYQLNSECNSDVICPPKCRCESGVVECSNLKLTKIPDRIPQSTAELR
LNNNEISILEATGIFKKLPHLKKINLSNNKVSEIEDGAFEGASSVNELHLTVNQLESVRS
GMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQISTIAPGAFDTLQSLSTL
NLLANPFNCNCQLAWLGDWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCEEGKEET
TCIPRPQCPQECTCLDTVVRCSNKHLKALPKGIPKNVTELYLDGNQFTQVPGQLSTFKYL
QLVDLSNNKISSLSNSSFTNMSQLTTLILSYNSLQCIPPLAFEGLRSLRLLSLHGNDISS
LPEGIFADVTSLSHLAIGANPLYCSCNLRWLSSWVKTGYKEPGIARCAGPPDMEGKLLLT
TPAKKFECQGERCPCCLPIPSRGGSNIHLVPLQTSGPTIFAGRDCEVALSGCSSNPCANG
GTCQPQEGEGAGFRCLCPVGFEGQSCHSTSDPCKEHSCENGGSCVPSATNYTCLCPAYYT
GEFCEQPPNFCSDELNPCQHDSTCISTSQGPRCECAPGYVGSNCSEDFDDCQDHRCQNNA
RCLDEVNGYSCLCTEGYSGQLCEMPPHTAGQPGLCERAECQNGAPCVERGARALCQCLPG
FGGPKCEKLLSVNFVDRDTYLQFTDLQDWPRANITLQVSTAEGNGILLYNGDSDHMAVEL
YQGHVRVSYDPGTHPSSAIYSAETINDGQFHTVELVTFDQMVNLSIDGGSPMTMDNSGKH
YTLNSEAPLYVGGMPVDVNSAAFRLWQLLNGTSFHG
Download sequence
Identical sequences H0ZHR8
ENSTGUP00000010134 59729.ENSTGUP00000010134 ENSTGUP00000010134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]