SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010425 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010425
Domain Number 1 Region: 95-262
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0049
Further Details:      
 
Domain Number 2 Region: 241-357
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.31e-25
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 3 Region: 479-543
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-18
Family SH3-domain 0.0008
Further Details:      
 
Domain Number 4 Region: 564-596,630-717
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000000235
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010425   Gene: ENSTGUG00000010093   Transcript: ENSTGUT00000010535
Sequence length 751
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:49635718:49652727:-1 gene:ENSTGUG00000010093 transcript:ENSTGUT00000010535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGHHTPSAGGPFSALTPSIWPQEILAKYTQKEESVEQPEFRYDEFGFRVDKEDGAEPNSS
KLLGVPLTEEPQQRLKWQAHLEFTHNHDVGDLTWDKIEVTLPHSDKLRSLVLAGIPHSMR
PQLWMRLSGALQKKRNSEMSYRDIMKNSSNDETIAAKQIEKDLLRTMPSNACFSNMNSIG
VPRLRRILRGLAWLYPDIGYCQGTGMVAASLLLFLEEEDAFWMMCAIIEELVPASYFSTT
LMGVQTDQRVLRQLIVQYLPRLDKLLQEHDIELSLITLHWFLTSFASVVHIKLLLRIWDL
FFYEGSLVLFQVTLGMLSMKEDELIQSENSASIFNTLSDIPSQIEDADVLLREAMRVAGS
LTDVAVETQRRKHLAYLIAEQGQLLNSSTTVNNLSKIVRRRTQRRKSGITSLLFGDDDLE
ALKAKNIKQTELVADLREAILQVARHFQCVDPKNCIIDLTPDYSMESHQRDHENYVACSR
NRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDE
RSKEYSIAGDDSVTEGVTDLVRGTLCPALKSIFEHGLKKPSLLGGACHPWLFIEEAASRE
VERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQAVNMTHDAAHAQMDVKLRSLIC
VGLNEQVLHLWLEVLCSSLQTVEKWFHPWSFLRSPGWVQIKCELRVLGKFAFSLSQDWEL
PIKREKEKKPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences H0ZIK8
59729.ENSTGUP00000010425 ENSTGUP00000010425 ENSTGUP00000010425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]