SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010791 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010791
Domain Number 1 Region: 6-71
Classification Level Classification E-value
Superfamily UBA-like 0.00000000153
Family UBA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010791   Gene: ENSTGUG00000010462   Transcript: ENSTGUT00000010904
Sequence length 551
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:22321368:22363266:-1 gene:ENSTGUG00000010462 transcript:ENSTGUT00000010904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVNSPVNIKEKINAIRSIVPNKSNNEIVLVLQQFDNNVDKAVQAFMDGDATQVLKEWN
MTGKKKNNRRKRSKSKQHQGNKDSKNKNSGPEKASQEPQRINDCHMNGCPKDNSGRGSAN
QKLETTSLEKKSSTFRSVPLTESTFPTGKRERQRVSVESNPKTVNGVEQHEPLQSPVQLQ
CNLGRPKSSSVKSPNVSTQLETKTDDSVKKRGPNIEKSVKDLQRCTVSLTRYRVMIKEEV
DNSVKKIKAVFAELHSCIVDKEVSLMAEIDKVKEEAMEILTARQKKAEELKRLADLASQM
AEAQLSELRAEIKHFVSERKYDEELGRSARFSCDTEQLKTQIQLCGEISHPKNSYSSRTP
CSLLLSSMTSHATAGKQNTHNRKSSSNAKNSDKTASSKVQSYPSSNPTESSSQGVPTNKH
NGPSNQRRRFNPQHQNMRLNGSHKSQGASNEADQNTKSGSKSEHRRQQHNSFRSKNKGAV
KNQEPSTTARTTENPTHSEKSRRKHHTPDTAEHRPFQGSVGRVSQCNLCPARMEVSADAT
VLSVPAVTLVA
Download sequence
Identical sequences H0ZJM2
ENSTGUP00000010791 ENSTGUP00000010791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]