SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011043 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011043
Domain Number 1 Region: 12-78
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.05e-16
Family Ovomucoid domain III-like 0.0056
Further Details:      
 
Domain Number 2 Region: 107-171
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000208
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 3 Region: 204-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000067
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011043   Gene: ENSTGUG00000010716   Transcript: ENSTGUT00000011163
Sequence length 317
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:25151860:25283243:1 gene:ENSTGUG00000010716 transcript:ENSTGUT00000011163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYDDRENDLFLCDTNTCKFDGECLRIGDSVTCVCQFKCNNDYVPVCGSNGDTYQNECYLK
QAACKQQSEILLVSEGSCATDAGSGSGDGVNEGSGETSQKETSTCDICQFGAECDEDAED
VWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNATTTTKS
EDGHYARTDYAENANKLEESARGIYIPCPEHYNGFCMHGKCEHSTNMLEPSCRCDAGYTG
QHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAIICVVVLCITRKCPRSNRIHRQKQN
TGHYSSDNTTRASTRLI
Download sequence
Identical sequences H0ZKC3
ENSTGUP00000011043 ENSTGUP00000011043 59729.ENSTGUP00000011043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]