SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011678 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011678
Domain Number 1 Region: 140-336
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-57
Family Prokaryotic proteases 0.000000645
Further Details:      
 
Domain Number 2 Region: 351-447
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-22
Family HtrA-like serine proteases 0.0025
Further Details:      
 
Domain Number 3 Region: 6-92
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000439
Family Growth factor receptor domain 0.0014
Further Details:      
 
Domain Number 4 Region: 80-125
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000088
Family Ovomucoid domain III-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011678   Gene: ENSTGUG00000011319   Transcript: ENSTGUT00000011805
Sequence length 450
Comment pep:known chromosome:taeGut3.2.4:6:31806664:31840574:1 gene:ENSTGUG00000011319 transcript:ENSTGUT00000011805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALPACPERCDRSRCPALPAGCPGGPVPDACGCCRVCGAEEGEACGGAGPPCGEGLQCVL
PPGAVPASATVRKRAAAGRCQCTSSEPVCGSDAVTYASHCQLRAASRRAESLRQPPIIAI
QRGACGQGQEHPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVS
EDGLIVTNAHVVTNKNRVKVELKNGETYEAKIKDVDEKSDIALIKIDSQGKLPVLLLGQS
ADLRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGG
PLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAVTKKKYIGIRMMSL
TPSKARELKDRHKDFPDVVSGAYVIEVIPETPAEAGGLKDNDVIISINGQSISSASDVSD
IIKKDSTLHMVVRRGNEDVMLTIVPEEIDP
Download sequence
Identical sequences H0ZM55
ENSTGUP00000011678 59729.ENSTGUP00000011678 ENSTGUP00000011678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]