SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012183 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012183
Domain Number 1 Region: 317-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.57e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 159-265
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 455-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.008
Further Details:      
 
Domain Number 4 Region: 283-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000457
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012183   Gene: ENSTGUG00000011821   Transcript: ENSTGUT00000012317
Sequence length 678
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:62134723:62199667:-1 gene:ENSTGUG00000011821 transcript:ENSTGUT00000012317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADLSVEECCDKGVEWANKNRICASLPLISESRECSMTQVQCCRSQLQKQSCSDGLEFASA
REECDSHLPKNSTCEAEYFKTCCYCCLLGKAAQVQGQSCEPNPKIGYQCGIVFRTCCGKG
QEGIDLSISDYAPKKEPVEISKEELDQEDPYLHDGCRGGGPCSQQCRDTGSSYVCSCFVG
YQLQPDGLTCEDINECITGTHNCGIGQTCVNTLGSFRCQRDTSCGTGYELTDDSRCKDID
ECETGTHNCPPDFICQNTPGSFRCRPKLQCMSGFIQDALGNCIDINECLSANTPCPAGQI
CINTDGSFTCQRISPSCGRGYHLNEDGTRCVDVDECSSSNQPCGEGHICINAPGNYRCEC
KAGYTFDVISRTCIDINECRRYPGRLCAHKCENTPGSYYCTCTVGFKLSADGRSCEDLNE
CESNPCSQECANVYGSYQCYCRRGFQLSDIDGISCEDIDECALPTGGHICSFRCINIPGS
FQCTCPSTGYRLAPNARNCQDIDECVAENHNCSFNETCFTQGGFRCLSWICAQKLRSSTR
CVRLEKTDTIRCIKSCRPNDVSCLLDPVHTISHTVISLPTFREFTRPEEIIFLRAITPTY
PANQADIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIIGPFHAILKLEMNYVMGGV
VSHRNIVNVHIFVSEYWF
Download sequence
Identical sequences H0ZNK6
ENSTGUP00000012183 59729.ENSTGUP00000012183 ENSTGUP00000012183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]