SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012653 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012653
Domain Number 1 Region: 265-446
Classification Level Classification E-value
Superfamily MIR domain 1.03e-53
Family MIR domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012653   Gene: ENSTGUG00000012288   Transcript: ENSTGUT00000012794
Sequence length 683
Comment pep:novel chromosome:taeGut3.2.4:5:39440288:39463028:-1 gene:ENSTGUG00000012288 transcript:ENSTGUT00000012794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFTIRFHRMREPPQVCWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTF
PFQKPGDRYEQHNYVGMRGFCAFLGSCLVPFAYLTVLELSKSLPAALLTAFILIFDTGCI
TLSQYILLDPILMFFLMGAVLSMVKCNSCADRPFSASWWFWLSLTGVSLAGAMGVKFVGL
FVVLLVGLNTIYDLWDLLGNLSLSLVMFGKHLLARVLCLIVLPLALYTAVFAVHFAVLNR
SGPGDGFFSSAFQSQLIGNNLHNVSIPEHLAYGSVVTMKNLRMAGGYLHSHWHLYPEGIG
ARQQQVTAYLHKDLNNLWIIKKHDSDTDLSDPSGPVEFVRHGDIIRLEHKETSRNLHSHQ
HEAPLTRKHFQVTGYGINGTGDSNDFWRIEVAGRRTGELIKVLRSQVRLTHVATGCILGS
SGKTLPKWGWEQVEVTCTPYLKETPNSLWNFEDHINPKLPNISLDVLKPSFAEILLESHM
VMIRGNSGLKPKDNEVTSKPWHWPINYQGLRFSGVNETDYRVYLLGNPVIWWLNLVTIGL
YLLITVATAVALKRGVQLTSELKELSRVVLHAGGQITLGWLLHYLPFFMMGRVLYFHHYF
PAMLFSSMLTGITWDALLKFCAGLLSPSTTARRVYGGGFLALVLLILYSFYLFHPLSYGM
IGPLASNPSSPMAGLRWMDSWEF
Download sequence
Identical sequences H0ZPX0
59729.ENSTGUP00000012653 ENSTGUP00000012653 ENSTGUP00000012653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]