SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012974 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012974
Domain Number 1 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000121
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 892-944
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000473
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 728-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000141
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 392-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000194
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 949-998
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000158
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 859-900
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000239
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 7 Region: 766-824
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000379
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012974
Domain Number - Region: 299-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000127
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 2-26,103-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00354
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 434-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00672
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number - Region: 343-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0794
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012974   Gene: ENSTGUG00000012603   Transcript: ENSTGUT00000013122
Sequence length 1228
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:149443106:149507740:-1 gene:ENSTGUG00000012603 transcript:ENSTGUT00000013122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIFMCKLCNLFSPSKSELLSHVSEKHTEEGTGVDDIIIPLQPLTVPTNTSKDGKELLVAK
RKRGRPKGSTKKFCVDEDVAENNPVPSKETPAGTEEGPEPSEVSAGSLECRKCNRKFSNT
RQLTKHICIIVLNEGEEEGDGGNDSDVDLDRKEDEREKTPKRPRVQRTEKTASTKETEQI
SGAKNPIISVVLTAHETIPGARKIVPLEASSRASEPKTPDTTVQDPSQRKGYQEYAIQQT
PYEQAMKTSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCSYCSYASAIKA
NLNVHLRKHTGEKFSCDYCTFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLIKH
MKETHDLQDKKVKDVFDELRLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDERPF
ACELCGHGATKYQALELHVRKHPFVYVCSVCLKKFVSSVRLRAHIKDVHADLQEDFVFNN
SINQSFCLLEPGGDIQPEALGEQQTQTAGESTVTSADAVNTPQPSASKGESAAADVNHDG
QHNVFSLELENPLVKNVAETLCQTTDVAVPDIQPCVGSDCFLLKNGTAGPEELQDSPPNE
EEVNHCSSVNNQGEEIHLLLSEDKSLNVSQNNTVTEDLPVLEERIQSVPPGESETSNPPI
QNSAEPTDPLAAAEAGAATSPQAASSNTATASGGNGSVAFMQILDSLQKRQMNTELRDRI
RKVYGDLECEYCGKLFWYQVHYDMHVRTHTREHLYYCSQCSYSSITKNCLKRHVIQKHSN
ILLKCPTEHCDYSTPDKYKLQAHLKVHTDLDKKSYSCPVCEKSFSEDRLIKSHIKTNHPE
VSMTTISEILGRRVQLKGLIGKRAVKCPHCDFYFMKNGSDLQRHIWAHEGVKPFKCSLCE
YATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCTVCDYTA
AQKPQLLRHMEQHVSFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYVNAGSGEPAAEAL
IQQGGIKCPVCSFVYGTKWEFNRHLKNKHGMKLVENDGETKWELTAEVSEEASTQYLHIT
EAGEDVQGTQAAVAALQNLRYTSENSEGLDPTAVNILQQIIELGSESHDATAVASVVTMA
PGTVTVVKQVKEEEQSANHTLMIQETLQQASVELSEQHHLVVSSDEVEGIETVTVYTQGG
EASEFIVYVQEAVQPVEEQAVEESVQEL
Download sequence
Identical sequences H0ZQT4
ENSTGUP00000012974 ENSTGUP00000012974 59729.ENSTGUP00000012974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]