SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013003 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013003
Domain Number 1 Region: 108-495
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.91e-73
Family Ankyrin repeat 0.0000156
Further Details:      
 
Domain Number 2 Region: 584-630
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000222
Family SOCS box-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013003   Gene: ENSTGUG00000012632   Transcript: ENSTGUT00000013151
Sequence length 634
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:46361418:46383168:-1 gene:ENSTGUG00000012632 transcript:ENSTGUT00000013151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTAANTQRQTIGCEEYSLYSSLSEDELIKMAIQQSLEEDSAGQPVAQSPQNRASPHNP
PYRIYPWQSPSCSPESPGRRGRQAPSWGVRRRYDSSQFSTSQPVEIDPVVAAIRDGDEKA
VCNMMKSGKNLSVPNKDGWIPLHEAAYYGQVGCLSLLQKAYPGTIDQRTLNEETALYLAT
SRGNLDCLLTLLQAGAEPDISNKARETPLYKACERKNAEAARLLVQYNADTNHRCNRGWT
ALHEAVSRNDLEIMDILVKGGAKIESANAYGITSLFVAAESGQLEALRYLARCGADINTQ
ASDNASALYEACKNGHVPIVEFLLSQGADANKANKDGLLPLHIAAKKGICEIVSMLIPVT
SRTRVKRSGISPLHLAAERNNDDILEELIDAGYEVNTALSDERSCLYEDRRTTPLYFAVF
NNNIYATELLLQAGANPNVDLINPLLISIRHGCLKTMKLLLDHGANIDAYISSHPTTFPA
TIMFSMKYLSVLKYLLDLGCDAGSCFECQYGNGPHPALNYRRERLNDPQVTREPAVVQFC
EMVSTPEISRWAGPIIDVLLDYVGNVQLCSRLKEHIDSYEDWAVIKEKAEPPRPLSHLCR
IKVRSLVGRNRIKLLDTLPLPDRLIRYLQHDYSQ
Download sequence
Identical sequences H0ZQW2
ENSTGUP00000013003 ENSTGUP00000013003 59729.ENSTGUP00000013003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]