SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013113 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013113
Domain Number 1 Region: 19-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-31
Family Laminin G-like module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013113   Gene: ENSTGUG00000012730   Transcript: ENSTGUT00000013262
Sequence length 878
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:85199974:85259993:1 gene:ENSTGUG00000012730 transcript:ENSTGUT00000013262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DICPTIRIGQDDLPGNCCFDLISQFQIEKAASQGIIERVVGSTSLQVAYKLGPNVDFRIP
TSAIYSNGLPDEYSFLTTFRMTGATLQKYWTIWQIQDSSGKEQVGVNLNGQMKSVEFSYK
GADGRHQTASFLHLPFLFDSQWHKLMIIVEANSVTLFIDCIKIESLNIKPKGKINTDGFA
VLGKLKNNPQISVPFEIQWMVIHCDPLRPQREGCGELPARVRNLPWAGSRGPPGPPGPPG
PPGPPGVPGIDGVDGERGPKGPPGPPGPDGDAGKPGSPGLPGEPGADGFTGPDGSRGAPG
PKGQKGEPGQPGARGLPVIYGIWGKNGPAGAAGLPGEVGLAGPPGDPGKRGPPGLPGPPG
PPVSDIFNVGKGICPSACPPGRPGHAGLMGMKGQKGSKGESGEPGKQGYKGEEGDQGPSG
EVGAQGPPGILGIRGITGIMGPKGTKGARGLDGDPGPQGLPGAPGDQGQRGPLGEAGPKG
ERGPQGTRGINGLPGTKGEPGLPGVDGREGIPGMPGAKGEPGKPGAPGDTGLQGLPVRES
IHNARGNSALRGNRGPPGVPGLMGNPGKQGQQGPEGEAGPTGPRGPPGSRGETGPAGPPG
LPGKLGPQGSIGLPGLPGPPGLPGSKGDRVRNALYRPLKNHATTDSSCLLKKKIYIEQLH
FGSHFFAFVGNPGDPGSRGPEGSRGLPGMEGPRGLPGPRGLQGEQGAPGLPGSEGPAGKE
PSDQHIKQVCMRVMQEQLAQLAASLRRPEFGAPGLPGRPGPPGAPGPAGENGFPGQLGPR
GLPGLKGPPGEIGRKGPKGEPGERGERGFPGRGLKGHPGPRGLPGEPGKASYGREGRDGD
RGPPGVAGQPGVPGPPGPPGPPGYCEPASCRMQAGQRA
Download sequence
Identical sequences H0ZR71
59729.ENSTGUP00000013113 ENSTGUP00000013113 ENSTGUP00000013113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]