SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014125 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014125
Domain Number 1 Region: 61-122
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000834
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 9-76
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000987
Family Complement control module/SCR domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014125   Gene: ENSTGUG00000013722   Transcript: ENSTGUT00000014289
Sequence length 205
Comment pep:novel chromosome:taeGut3.2.4:Un:58136629:58140266:1 gene:ENSTGUG00000013722 transcript:ENSTGUT00000014289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETPWCSPIKVKHGYANCRTPQGEYYKNVLGTRCDIRCQKYELHGPHQLICQSSKRWSGKV
LCKQKRCPTLSMPTNGGFKCLDGAYFGSRCEYYCSPGYQLKGERVVTCLDSKAWSGRPAA
CVDTEPPRIQCPSVKEKSAEPNKLTARVFWDTPEGRDTADGILTDVILKGLPPGSHFPEG
DHKIQYTVYDRAENKGTCKFLVKVR
Download sequence
Identical sequences H0ZU28
ENSTGUP00000014125 59729.ENSTGUP00000014125 ENSTGUP00000014125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]