SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014424 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014424
Domain Number 1 Region: 88-212
Classification Level Classification E-value
Superfamily Cupredoxins 7.09e-29
Family Multidomain cupredoxins 0.0000254
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily Cupredoxins 3.85e-23
Family Multidomain cupredoxins 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014424   Gene: ENSTGUG00000014031   Transcript: ENSTGUT00000014607
Sequence length 213
Comment pep:novel chromosome:taeGut3.2.4:Un:31420114:31423499:1 gene:ENSTGUG00000014031 transcript:ENSTGUT00000014607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GALYPDGTGGKSKEDDFVVPGGNYTYTWPVRKDYSPTLADSNCLTWIYHSHIDTPRDIAS
GLIGPLLVCKKGTADETTLEGTGAANAFALMFSIVDENFSWYLDENINTFCLEPDTVNKE
DEGFQTSNRMHAINGYIYGNLPGLEMCADTSMSWHLVWHGEIDIHAAYFYGHFTSRDQRA
DVVGLFATFITAEMTPAPGRWLITCQVNEHLRS
Download sequence
Identical sequences H0ZUX7
ENSTGUP00000014424 59729.ENSTGUP00000014424 ENSTGUP00000014424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]