SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016923 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016923
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Cupredoxins 2.31e-19
Family Peptidylarginine deiminase Pad4, N-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 85-128
Classification Level Classification E-value
Superfamily Peptidylarginine deiminase Pad4, middle domain 3.01e-17
Family Peptidylarginine deiminase Pad4, middle domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016923   Gene: ENSTGUG00000016621   Transcript: ENSTGUT00000017277
Sequence length 129
Comment pep:novel chromosome:taeGut3.2.4:21_random:224233:225490:1 gene:ENSTGUG00000016621 transcript:ENSTGUT00000017277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPAGAVAFGVKHTEGVSVDVLFRGRAEPEPVSGAGVRWPLDEGTVLRFSMSRASAEVND
NKVTVSFYAEGGKPINQAGVFLTGVGISLDVDADRDGVVEKNSPNKASWAWGPEGHGAIL
LVSCDKESP
Download sequence
Identical sequences H1A211
59729.ENSTGUP00000016923 ENSTGUP00000016923 ENSTGUP00000016923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]