SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017591 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017591
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-31
Family C-type lectin domain 0.00000938
Further Details:      
 
Domain Number 2 Region: 281-354
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 405-478
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000118
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 337-404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 159-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 221-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000653
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 461-527
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000806
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017591   Gene: ENSTGUG00000017314   Transcript: ENSTGUT00000017993
Sequence length 563
Comment pep:novel chromosome:taeGut3.2.4:8_random:2211211:2216072:1 gene:ENSTGUG00000017314 transcript:ENSTGUT00000017993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTYHYSDTNMTYREAEQWCRKKYTNLVAIQNKEEIKHLNAFLPFNPGYYWIGIRKINGVW
TWTGTNKELTEEARNWASGEPNGKGNNEDCVEIYIKRGKDDGKWNDEQCEKKKVALCYTA
SCNPSLCSGHGECIETINNHTCHCNPGFYGPECEFVKSCDPLEKPDHGSLECHHPLGDFS
YNSSCTVQCEEGYELTALESVHCTSSGIWSAPLAACKAVTCPALEMPIHGAVNCSHPSVQ
LTWGTTCEFTCEEGFTLTGPATLQCGSSGAWDRQQPTCAAVRCEAVPRPAEGSVSCDHAP
AELTSGSRCDFQCQEGYVLEGSPSTECTAQGQWSEPVPKCKAVTCPALEMPIHGSVNCSH
PSVQLTWGTTCEFTCEEGFTLRGPATLQCGSSGAWDRQQPTCAAVRCEAVPRPAEGSVSC
DHAPAELTSGSRCDFQCQEGYVLEGSPSTECTAQGQWSEPVPKCKVIQCEPLSSPEKGSM
DCSHRAGMFTYNTSCHFSCLEGWSLNGSRVLQCSHSGNWSASLPTCEASDQASYISVGIA
ATSASLLSSASFLLWLARRFRRK
Download sequence
Identical sequences H1A3X7
ENSTGUP00000017591 59729.ENSTGUP00000017591 ENSTGUP00000017591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]