SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000018116 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000018116
Domain Number 1 Region: 99-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000289
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 3-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000671
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 67-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000146
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000018116
Domain Number - Region: 35-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000018116   Gene: ENSTGUG00000018165   Transcript: ENSTGUT00000018922
Sequence length 137
Comment pep:novel chromosome:taeGut3.2.4:7:34222001:34226952:-1 gene:ENSTGUG00000018165 transcript:ENSTGUT00000018922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQCEPPCEHGGTCLPHNTCSCAYGFVGPRCETMVCSRHCHNGGVCVSPDECQCRHGWSSP
SCETAVCNPVCLNGGVCVRPNTCSCPSGFYGPQCQRALCIPPCKNGGHCVRTNVCSCAEG
YTGRRCQKSELNISLCF
Download sequence
Identical sequences H1A5F0
ENSTGUP00000018116 59729.ENSTGUP00000018116 ENSTGUP00000018116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]