SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_05730--XP_001121321.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_05730--XP_001121321.1_APIME
Domain Number 1 Region: 6-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_05730--XP_001121321.1_APIME
Sequence length 68
Comment [mRNA] [translate_table: standard]
Sequence
MMTNTTDACETRDPCQHGGICISTDSGPICECRTGDYEGAYCEKEAWSTVLPTAGAGDYW
AWDYSESR
Download sequence
Identical sequences E2CAF7
Hsal_05730--XP_001121321.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]