SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_06056--XP_393267.2_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_06056--XP_393267.2_APIME
Domain Number 1 Region: 47-331
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.96e-105
Family Inorganic pyrophosphatase 0.0000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Hsal_06056--XP_393267.2_APIME
Sequence length 334
Comment [mRNA] [translate_table: standard]
Sequence
MFPMKLSHMLRYYGFLRLVTSPSRVVAAGREVRVFGAFAKLCRNMSYTTVERGALNSTDY
RVYFKNDTDIPISPMHDIPLYADKENKILNMVVEIPRWTNAKMEISLKEALNPIKQDVKK
GKLRYVANCFPHHGYIWNYGALPQTWENPDVLDEATGCKGDNDPIDCLEIGYKVAKRGEI
LKVKVLGTVALIDEGETDWKIIVIDINDPLADQMNDVNDIEKHCPGLLKATIEWFKIYKI
PDGKPENQFAFNGEAKSREFALSIVDEVHEHWQHLIQQETDSGGIICSNVTVEDSPYKIT
AEAAEEILEKAPKAELELQSVESIVDKWHYVHLK
Download sequence
Identical sequences E2BJX8
XP_011140233.1.56509 Hsal_06056--XP_393267.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]