SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_07706--XP_393275.3_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Hsal_07706--XP_393275.3_APIME
Domain Number - Region: 105-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_07706--XP_393275.3_APIME
Sequence length 129
Comment [mRNA] [translate_table: standard]
Sequence
MRGATFTIHLDGPAENSSRNATKINEENGTDRLELRATSQGPNLEQKLPSTMESIVSTEP
ACSLDCGPAGNCYIEQSRGDEVDVVIEDDDEGAMDLEGNSVNLRRKQETFRQRCQCPLGR
GGDRCQLGE
Download sequence
Identical sequences E2BNU9
Hsal_07706--XP_393275.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]