SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_08518--XP_397225.3_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_08518--XP_397225.3_APIME
Domain Number 1 Region: 376-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000558
Family EGF-type module 0.083
Further Details:      
 
Weak hits

Sequence:  Hsal_08518--XP_397225.3_APIME
Domain Number - Region: 82-155
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00822
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.071
Further Details:      
 
Domain Number - Region: 229-273
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0102
Family beta-sandwich domain of Sec23/24 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_08518--XP_397225.3_APIME
Sequence length 430
Comment [mRNA] [translate_table: standard]
Sequence
DPCYDEDRPRRCIPDFVNAAFGASVEASSTCGTGGPTRYCDVTEQPGGTSGFGHCHVCDD
STPRRRFPASYLTDLNNPNNVTCWRSEPLVSSQSFSAPPDNVTLTLSLGKKYELTYVSLQ
FCPRAAKPDSIAIYKSMDYGKTWQPFQFYSSQCRRVYGRPNRATITKSNEQEARCTDSHR
YTGGDGLGPVGRIAFSTLEGRPSANDFDNSPVLQDWVTATDIRVVFNRLHMPQQPSQEQQ
QQQQQQQQVVSSHLGNAEDHHSSPMGSSSALGLEELAKREREREERLKSQKNAILHGEPL
VTAVPSVHQVIAPQEMQSNDALDAAVRDMASCRSPPPRLRPSRCWWGGAGGGAVGPVAPT
MAHHYAVSDFAVGGRUKCNGHAARCIPGKGGEVVCECRHNTAGRDCERCRPFHFDRPWAR
ATARDANECK
Download sequence
Identical sequences Hsal_08518--XP_397225.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]