SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_08519--XP_001122402.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_08519--XP_001122402.1_APIME
Domain Number 1 Region: 113-252
Classification Level Classification E-value
Superfamily TIMP-like 9.73e-35
Family Tissue inhibitor of metalloproteinases, TIMP 0.064
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000279
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 3 Region: 64-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000343
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_08519--XP_001122402.1_APIME
Sequence length 252
Comment [mRNA] [translate_table: standard]
Sequence
CNCNLHARKCRFNMELYKLSGRVSGGVCLQCRHSTAGRHCHYCKEGYYRDPARPITHRKA
CKPCDCHPIGASGKTCNQSTGQCPCKDGVTGTTCNRCARGYQQSRSHIAPCINQCGKCRA
STKRLNLNKYCKRDYAILGRITDRHKKSDGSQPGTSVSGTSWIRFTLNVDFIYKKNPNSR
IRRGDVSLYVHSADLACRCPKIKPNKSYLILGQESDGGGQGGLTVTQRSIVIEWRDEWHR
RMRRFQRRARSC
Download sequence
Identical sequences E2BUA0
Hsal_08519--XP_001122402.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]