SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_11062--XP_001599196.1_NASVI from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_11062--XP_001599196.1_NASVI
Domain Number 1 Region: 72-109
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.00000000000445
Family Ribosomal protein L36 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_11062--XP_001599196.1_NASVI
Sequence length 130
Comment [mRNA] [translate_table: standard]
Sequence
MNTGLLLRSVYRAINIVPKILVWQPIQNILARNIHFICDRRKLNLTPNSLPDHSTSVILP
CITPMYNSICSLKTRGVLQRRCKDCYFVSRHERLYVMCKSHPRHKQVQMKKREYKTWILT
SVSQKKKRDW
Download sequence
Identical sequences E2BEP3
Hsal_11062--XP_001599196.1_NASVI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]