SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_01917--NP_001011577.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_01917--NP_001011577.1_APIME
Domain Number 1 Region: 38-220
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000115
Further Details:      
 
Domain Number 2 Region: 214-333
Classification Level Classification E-value
Superfamily E set domains 2.12e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Hsal_01917--NP_001011577.1_APIME
Sequence length 817
Comment [mRNA] [translate_table: standard]
Sequence
MEQFNNMTSENINISDILEVIQTTDPGSMATIAMDNEQPYVKIMEQPASKALRFRYECEG
RSAGSIPGANSTPENKTFPSIRIIGYKGRAMVVVSCVTKDAPYRPHPHNLVGKEVCKQGV
CTVEVPAGNMIVTFSNLGIQCVKKKDIEEALKVREDLRVDPFRTGFEHKKQPTNIDLNAV
RLCFQVFLEGSRKGKFTRPLTPIVSDPIYDKKAMSDLVICKLSHCSASVAGGMEMILLCE
KVAKEDIQVRFFEEDDGQLLWEGFGDFQPTHVHKQTAIAFRTPTYRMQQVEQPVQVHIQL
KRPSDGATSEPLPFQMLPLGTGRPAFWSLRKAFARKKADYSTFSKILATETALLSNVSAP
KFPRNIDEFNNNDLDAKRSNGKISALRALNDLYNVRNHIDACNGDLKAIINSAQNDQIAK
STVLDYENNEVTVIPENYRDADNNKDVTKLYTLGNNHNLENDTFITDYNKEGTIGVVPHV
KSDMQNDSAFASKDQMKIGNSRERSDWFDYSEIGKWVQKGQACLKEKNDETELKSETESG
NKSFNEFLSQVAELDQIYADTHTKLVQAALEPNAHPQLMDVDVCDNQTYTSLQMAMKNPI
ELFDITDERKYEDIATPKQDAEVPVSPPTLAAKRDVTREAEERLPPLPPKRIRKMPSMPL
LPRPISSQTLADSSTSEAPNKNLPSLPDTLPKHSKQGLFSKLFAKKTKKDKCSVPNLSMD
SDSSLNTSYSLKNSIQDASQLQLPRPSMTSVTSVKSLRLDDDDDDITPPYGADLTEAEHY
ALYTTMAPHATASEFDDMSFYYSLVEGGKILTEAKET
Download sequence
Identical sequences E2C1P0
Hsal_01917--NP_001011577.1_APIME XP_011149046.1.56509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]