SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_02026--XP_623868.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_02026--XP_623868.1_APIME
Domain Number 1 Region: 8-130
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 6.8e-31
Family Rap30/74 interaction domains 0.00017
Further Details:      
 
Domain Number 2 Region: 186-252
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-22
Family DNA-binding domain from rap30 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_02026--XP_623868.1_APIME
Sequence length 272
Comment [mRNA] [translate_table: standard]
Sequence
MSTNVTHMEKELDLSNAGRGVWLVKVPKYIANKWEKAPGNIEVGKLKITKNPGQKAEVSL
RLSEAVLALKESGEEEIPKQHRLDVTTVTTQILGVFSHVTPSTSSDAIVPETEKIFMEGR
IVQKLECRPYADNCYMKLKLESIKRASVPQRQVQQLDRVVQNFKPVSDHKHNIEYAEKKK
AEGKKMRDDKEAVLGMLFAAFERHQYYNIKDLVKITRQPIVYLKEILNEVCNYNLKNPHR
NMWELKPEYRHYKEDEKVTESTSKKDDDSEDD
Download sequence
Identical sequences E2BPI0
Hsal_02026--XP_623868.1_APIME XP_019697833.1.56509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]