SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_08218--XP_392121.2_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_08218--XP_392121.2_APIME
Domain Number 1 Region: 691-750
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 754-804
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 496-561
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 575-627
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 38-106
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000014
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 444-501
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000405
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number 7 Region: 637-667
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000602
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Hsal_08218--XP_392121.2_APIME
Sequence length 853
Comment [mRNA] [translate_table: standard]
Sequence
MLSAAGVSSSYMPEKYPVEVYHMLQERTQFGIGRDNRVRGTWGTWSEWSECSRSCGTGIQ
SQSRECVPLRRLLRRRSIISENGTSSVRPICIGTYRRYHTCNTQECPNFPEDPRAEQCAK
YNRRNYKGRSYVWVPFVDAPNSCALNCRAVGERFYATLEPAVIDGTPCDAPNLRGRGGGG
GGGGNGIGISTERNGERWLCVAGQCKSVGCDGVVGSDATMDACGVCGGQGRGCRLYEGIF
MEPILPKGHQQVTMIPKGAMSLNISELRFSSNFLALRDSNGSYILNGPWSYSPSGTYKAA
GTTLTYQRGDRNRMECILATGPLNESLHLEILSLDRNPGVLYKYMLPMREVPDGKAIIAP
PLLVAGSNDRGNEIPSPESHVTIRVPITRTSDRRGDLSSTRRDRDPARTQHVGRKEEMKH
PPTTVMAGDQPKSKARKKKRRKFAWKIADFAPCSEECGGGVRTAILKCIREDNQTLVNEK
RCRNLERPKHPPPLRCNDHPCVPRWRAEPWSECSVTCGAGIRTRKLECVQKMEGRLMRVA
ASACAQPPDLRTMEACSLSACPNTGPELRHMHSQHDAPRWNVGAWGPCSTTCGRGIRNRT
VTCITSGESCSLLNKPESQKPCEIAACNMVMDARHHAPWLYSEWSSKCSTECGNGVKTRR
VACADGSELFCNPKERPDMEMRCFGRGTSCDKAKWFTGPWTSCSVSCGVGVQRRSAVCLS
RTNDEFAVLPAKNCNEPKPASEQACRMSACSPEWFTSDWSTCSATCGFGVQTRLIRCIIE
GVGSSNCSEIGKPIGEQRCSVEPCKKESAVNKPPKKAHEPAKCVDKSPNCAVVVKNGLCR
VKYYNNMCCQCRQ
Download sequence
Identical sequences E2B927
Hsal_08218--XP_392121.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]