SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_08360--XP_392454.2_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_08360--XP_392454.2_APIME
Domain Number 1 Region: 1037-1330
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.65e-84
Family Complement components 0.0000154
Further Details:      
 
Domain Number 2 Region: 1400-1531
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.89e-31
Family Alpha-macroglobulin receptor domain 0.00064
Further Details:      
 
Domain Number 3 Region: 869-982
Classification Level Classification E-value
Superfamily E set domains 0.00000000252
Family SVA-like 0.051
Further Details:      
 
Weak hits

Sequence:  Hsal_08360--XP_392454.2_APIME
Domain Number - Region: 1782-1877
Classification Level Classification E-value
Superfamily TIMP-like 0.002
Family Netrin-like domain (NTR/C345C module) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Hsal_08360--XP_392454.2_APIME
Sequence length 1905
Comment [mRNA] [translate_table: standard]
Sequence
MDKLIVSCVLLVCLHAFLLPCEGLSSTSANRGYVFTAPRRFLAGETESGCLSLHNLEPPA
HVVLELLSPSITKDEVLARIETCLELVVPRTDNFKARLRLKITFDKYPDYVVETEKEVYI
EHDSLISFVETDKPVYKPGQDVNIRILMLKHDLKPWKKMIPKVWIENPSEIRVAQWTNVS
TENGMVQLKFPLSPEPSPGTWKVKVEKKKSQPQLVHTTMFEVKKYVLPRFQVTITSPGYI
LADAENVTWNICAKYSYGKPVKGTLLLKSTPQTPMWRRKSNLPEIHYETELDSPDGCTEF
VLSGAVLGLAHWKVAPNNIVLIANFTEAGTGIVETTTSRTVVVHQALKLEFLPYTPKYFK
LGLPYHGKLRVSRHDDTPAAHEKIQLCLRVRGKDEWLRVVVECRNFTSSSDGFVDFIVPL
SHRNIVLLSFVATGVDYPTKYYSPDTRWRVFMDQPSAHIDVSPWYSPSDSYLTVARGYQP
IVCGEKYSFNVMYTVPAKSKTNESISFHYSINSKGDLLIYGHVKHRPTRDTVLNYSEFRN
LLGAVETPGNKTSQDTIVHRFPLSVKITPSMAPISELLLYYVRPDGEIVATTYSIKVGHC
FENKVKSAWHTDVQTPGTATLYHVEAAPWSLCGISAVDKSTRFLGGSKSNLLDADQSFEQ
LKRFHIEPETRPIWTWTHCKTTTQHESNTEEIDHLPIPALRALPVWSRIRSRRTAMLHGD
VNYVDAVQAFDDFGAVVMSDLILETRPCPQFFTGFAQARDFLGVRNMVLRAGIEQEPAIV
NKAMRTLPMAVPLLNLSPEHSYVDSVPDQSVTLRSYFPETWLWELVPTGKEGKVTIERTL
PDTITDWIGYTTCISPTHGLGIAPPTTITGFQPFFLDYNLPYSVKRGELLRMKVSLFNYM
QHSLPVKIKLEDATGLDLHLSHAVASFCVKPRDSVVHEYILRPRVLGDVNITVSASIDSD
YAEPCGPETLLYTRDVIVKPILVLPEGFPVETTKSAFICPKDFSDDSTITWDLDLPEDLV
PESARAYVSLIGDILGPALENLDSLVRLPLGCGEQNMILFVPNIHVIGYLDATGVENSEL
RAKAVKNMEKGYQRELIYRHPDGSYSAFGPESSESSIWLTAFVIKSFAQARSIIHIDERD
LKISVKWMMKKQLENGCFPVIGRVFHKDMKGGLQDDDSSSTALTAYILISLLQSGVPLTP
SLVNNALHCLEKGMANGGDTTYTAALSTYALALLEHPRANNSLKLLMDRATRNHDLLWWE
DKYKPSLGLSIEMTAYAVLSFVKLGGEANMVEALKAVRWMSKQRNAEGGFTSTQDTVLGL
EALTKYAAAMSSNSTDLSVLVTAGDVDQVYRMHNDNRMVLTQIRLPILPTTVEIFAEGEG
CVLVQSNIKYNVAHATGSEAFDLSVGATSVLASVDECSMQKITICTRYKMADGESNMALL
EIGMISGYVPDRASLHSLLEDPATKVKRFEEDRDVVSIYFDKLISQKTCISLIVTRENIV
DRLEPANVKLYDYYQQELTISSSYSFAPTCSSANPSEEAEIPNPVPVEVEQPRKDNTKNI
GKDEIIEKAAKSGMGKEIPNPKNGIIEEASNASHKPAPQEDLVEQLRDKVTVAKPTLITG
IQSKYENVPLVENSNLKINTDDIASIANVRIGNNNGIVSGNADVPQTEIGSGQTPDEPDI
NLNPIFDRLEPPSVSLEDIEGSSVFNKQDQDANFDGNPNFVVVDHELATPDGIEGPTPVY
IKPDTTNIDSETPLDTINLTVSAENVDPSEVPSQSSPSALASNKSCPVCGDELPSDINEF
YCSANSVVKAAIRRLRKARLLLDISPSQPVKRLRSTIAFVLDPNCSCPPLDKPGDLALMM
HHADNEFGKRSHSQYVLDEWVSIYGLQPVGGVPQEIIDARLTCTK
Download sequence
Identical sequences E2BXH3
Hsal_08360--XP_392454.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]