SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_09689--XP_001123130.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_09689--XP_001123130.1_APIME
Domain Number 1 Region: 322-563
Classification Level Classification E-value
Superfamily vWA-like 6.01e-78
Family Integrin A (or I) domain 0.000000681
Further Details:      
 
Domain Number 2 Region: 556-651
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-18
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 833-917
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000876
Family Integrin beta tail domain 0.0016
Further Details:      
 
Domain Number 4 Region: 181-234
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000126
Family Plexin repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 742-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  Hsal_09689--XP_001123130.1_APIME
Domain Number - Region: 792-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000159
Family Integrin beta EGF-like domains 0.0074
Further Details:      
 
Domain Number - Region: 662-688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 711-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_09689--XP_001123130.1_APIME
Sequence length 990
Comment [mRNA] [translate_table: standard]
Sequence
MTERVNAIGTSLRLLALVWLSCATRYKFSAVAQPLPLAPDFTYGDLVAGDPESLMLLNRL
KQVTEQKHRVVEQEHEITDEQINIEAMLQAKAMEQQRGQTDYPVEEAEPEPEPEPEALPV
PAAMVHRGQQQPTSGKRKPNSGVTCKMFGSSRWLVIVGVLIGVLLAVFAQGNYGPPERLT
GMNPCISKQMCHECIQTPHCAWCAAPKFSEKRCFLPNINTKIFATCPPEYTWNPDNLFSM
LRHRNLTKGGYAAGGAGGGYDSIEGSYSGSSISSSSSSHFHKESSSDSSSRRQEAVQMWP
QEVNLMLRINEAYRMSFAYSQAEDYPVDLYYLMDLSKSMEDDKQKLSDLGQLLVESMSKI
TSNFRLGFGSFVDKVVMPYVNTMSKSLIEPCEGCAAPYGYKNIMTLSQDTSHFAGLVRNA
SVSGNLDAPEGGFDAIMQAIVCRNQIGWREKARRLLVFSTDAGFHYAGDGKLGGIIKPND
GLCHLDVNGTYTHSSLQDYPSISQINLKVKQNAINIIWAVTEEQIDVYKRLTKHVEGSFA
GKLTDDSSNVVELIREQYDAISSSVEMKDTASSAVKVKYFSSCLGTGPAIETSKCDGLKV
GTKVEFIAEIEVTSCPANRSEWKQKFDIYPVGINETLTVNLEMLCDCECEREGPMYEERS
PECNGVGTLKCGVCECYDGFFGKHCECSPHQEMTGFDKHLQLCRPDNTTLVDCSGRGTCA
CGQCECEERENPEEIISGHFCECDNFSCDRDQGQLCSNHGTCECGQCVCNAGWTGPSCNC
RSSNDSCIAPGTTNGVLCSGHGDCVCGECICHEEGNTRYSGKHCNKCPTCPSRCEELKSC
VQCQMYGTGNYSDPEECAKNCKEFVPEGVETVIVDVDNDEVLCFGTDEDDCKYNFVYYYN
ETNCLKVRAQNDRECPPQVYMLGIVLGVIAAIVLIGLALLLLWKLLTTIHDRREFARFEK
ERMMAKWDTGENPIYKQATSTFKNPTYVGK
Download sequence
Identical sequences E2B3R7
Hsal_09689--XP_001123130.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]