SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_10662--XP_392788.3_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_10662--XP_392788.3_APIME
Domain Number 1 Region: 1000-1199
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.82e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 43-79
Classification Level Classification E-value
Superfamily WW domain 0.000000742
Family WW domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Hsal_10662--XP_392788.3_APIME
Sequence length 1204
Comment [mRNA] [translate_table: standard]
Sequence
MLTDDNCSRMEWVEIIEPRTKEHMYANLTTGECVWDPPPGVPVKKTDNNQWWELFDQNTS
RFYYYNATSQKTVWHRPTDCDIIPLAKLQTLKQNTEPPSGSTSDAQKVTEPRKKESVSTQ
TQTPSVSRSTRFNHQESPNLTPTLQVGSANKTRTSTVGVDLQTSPPSPSPSSRRHHHHHH
HHNNRHHRHHEVPTARRQHNHSQDSGRSSDSSVSHSRTSLESTSYRLLDSPHRHHHRSAA
QTPASTAQSSPRQHSGTLETRCHKSGTLESVKNQKSVSLGEPPPLGLSLSTSTPLFKKKT
FTDSQREGRTGNLDLDKSKNGRESSRGSYGPEPSTSPYRESMMESRVFRQEMPPYRPPEV
QLSHSYKSQGEKYGSLVESSNRYHRDREREMQHHRERVNSLDKTNPPAFYPSSMHTRNVN
KQDNTGSIGRRHHGCSASLSEANVRDMYGAMLSERNDPAKSLGRAAGVHSNSSKQRGGLE
AVERERERDRDREKEYRRNTACNNSLDCVPQPLGRSYSFVQQQKQQQKMQQQLHQQQQQQ
QQASRRRERDDDSMHERYLISQTHDQSRQRLSSNTSSSNSSNSSSNSAAGEETEGHAEGD
DSKKKRSNGNPSPPPSPFYGNLLSDADHLLPLQHYILQQAKLSGCYKFGDPLLVEEGEDS
LDEEGGRGESIGGRADDDSDDQFADDEAASNQGDSSSQEYLEDHYADLRNYDTAGLATYY
NTADTLTRPRPPSPPNIVAQIEARDSVVTTRQVSLPTCTVTSTATPSICTTIDNTDLDEA
RRDDSTGGGDIEKYAQDNLNLNCGRPKGLRLLFRKKFSVRDILSWSKDPIPQPMLAMVDG
EKLLKREACNLFRLVQVYMGDRKANVGMTLDGVAMDIVNTAFSKPPLRDELYVQICRQTT
ENPRKESLRRGWELMAVCLAFVPPSATFEPYLEGYMNRHRDPNFQFPEVAKWPIHVQVSH
YATVACRRLQRIGAHGKRQPRKATVEDIDQARIQIFRASMFGATLSEVMALQRDRYPLRE
LPWIQTTLTRQVLVRGGTLTEGIFRVSADADEVSSLKSCLDKFEDGAILAASQDAHAPAS
LLKLWVRELYEPLIPDSFYVECVSMRHDDPEASAANVAALVDRLPDLNRRVLCHLIRFLQ
IFARPEVVARTKMDANNLAMVMAPNVLRCTSQDPRVILENARKEMAFVRTLIESLDTAWV
DDLH
Download sequence
Identical sequences E2B3K8
XP_011137830.1.56509 Hsal_10662--XP_392788.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]