SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_10970--XP_391884.3_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_10970--XP_391884.3_APIME
Domain Number 1 Region: 1207-1403
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.82e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000216
Further Details:      
 
Domain Number 2 Region: 51-162
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-17
Family PDZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 978-1088
Classification Level Classification E-value
Superfamily PH domain-like 3.73e-17
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Hsal_10970--XP_391884.3_APIME
Sequence length 2231
Comment [mRNA] [translate_table: standard]
Sequence
MADDRNNHRSFVRQSHVVGHLSPPPPAPGPATGSSGVSGQTSSSRYVQKENTPPRGPRTL
LLRHGENGYGFTLRHFIVYPPESCCMLPGHERTKIDEPMDTIFVKQVRANSPAAEAGLRT
GDRVVSVDGTPTRGEQYASVVQRIQQAGPWLRLLVVSKEDDILQRYFGETAHNPETNQRP
RLRSPERLSQKQRRSISMIPGPSQRTRQSWVCSLPSSDSPASDPSSSSSSSSHPNHEEAS
RRSQQQQQQQQQQAFADNNSRMAPSMSTDSPYRRAQQIQQPLTEAQIAGALYDPSDDMVP
PAARNLQSLHETTDVTSGSQMYGRSSQDSRYDLYDRTRPESVYSRPSNEQIYDRINDPIY
ERVRVNETCFANDQHHHHQLQSLHHYQPSSLLRYPVSHAEPQVPIYRPTKRMVARRASEG
SGCSNVSGMKHDSETASYGSFDALRSSEPGSSRLSIESRRDSSPVSKDSVSPYDSNSTLT
GNECSDDSVIMSRLRKSFEQKAEFLRRPSHPIGWFVSGNDATSEPTSLPRSQASNGLNQA
VIQREFYARPQKLQRPIWPPGNEQQRQQSPTRRQSSMDGRSIPKSTVNLAGGKPSNQSVQ
RIKDVDSDSEYTKSQGDRGDQQQLVGDDQPVAGDHCYSLLYDDELAKETYLANAHGGGSG
KAAPEQQQQYRAMSKANFINTLSRIHENVTSTVGAIANQDMRNGTSSLPSSPGPDKKPGE
TKFPVPPQGLQIVSRRAKQFESGRLLSDEDEPASDRTNLYKSELSRLSNTRNVPNVAVRK
REFESKAESQESRRLPSRETKSLDTGAVSKGNRIIPIGSKHIHCEPPADYKESKAEMPIM
ETESVRLRARSNSVESWEATNGPARGSARHTWQTAEEDFAERRSSTEDNTPVNGSSPNGS
TKNGVVLRRQKNAQISDEDRATRRVSYLKATWSERMHVDSDLELSDTEPVHMHRSNSIAV
AHDTSNSCDGTAKDVEPVEQEGSLHVKFTVLDGKRSTDRSWKQVWGVLRGPIIYFYKDRH
SQSPSLSTENEANAGQTVDVRCSVVDVAEDYTKRKHVLRIANPTAEVLLQTEDAASMALW
LRSLHSQAAAERSSDVASCTSKQQAVPQTPTGPTTSSNAAVSPGNNQRLSPLPSHKGIKK
LTSFRNRSPTGQSPVNKTRKPSQTVEPLPSPKSKTWKGRMAKQFRRMHGQTGAPSSPTAQ
LPPEGATFKVPLELCPRAPDSDVPMIVEICTRIVEARGLEVVGIYRVPGNTAAISQLTDS
VNSGFNNVNFQDPRWSDVNVISSLLKSFFRQLPDSLFTAELYPMFIDADKIEDPQRRMTT
IRKLLRDLPEHHFETLKHLMLHLKKIVEHSETNKMEAKNLAIVFGPTLVRASGSRDNMVT
MVNDMSHQCKIVENLLNNVDWFFSEDDLDDLSRLSVNLSLPADSCEVEPTSNTNHSLLLN
NIQKIEGMRDMASARDIVSSIISAANKKIQRRRKTQDEIDNGEHDSDKAKAKQETENSPT
IRQSMALNERQCSVSEIVLMHESKNQSNHNMDRPDRSLSADATTNGGSSNGASPNRSKYA
THSSSVDSPRLSSETGLSSAETSSTVSSASNQTKQENDEIAIRTYAGLSATTQERIRRFE
QETRAMLQRDQHRQKREAEKREEERRRIEMEWQLAKREMENDDLLDSIVDTTVSPNLLSE
RLSGLNERLADKSLMDLSERPVRDSRSRSTTRSPLSLAMQQQPTIHQKTQATNQLSNVLG
EKMNNGVIKKFKTDKDPSMESICLPPVRYGSLDSLHEVHNFSQSSPSPSQQQRGVPGDVS
DDGSDLLTSLTTTFDRKWRSLVNQSSNQAQPPLEAAACNKDGAEQQEQKASASLKFKYPS
AEAYRDPSLHKSIDKSHLSRSKDDAPEKDTDSTVTDTHPSEAVTPNNDRSAGDKQQRSET
KTASGHGTDKTTEKTAANASEKDEDQKTADIGDCACTGSPKRYELPNATNLQEGKPTSAN
ACPEETDVDTKLEDGKGHHYESGDSSYSNKLKKFESLTNFEARSRLKRSESLNKRSESTA
SRLKRSESLNKHSSERLSSPTNGKLKRSESLNKHSDGRSESPGSKLKRSESLTKTEKTEC
NISKRRQSVRKESATKLKRKNGMPERSIKRRHTVGGTKDFDKVHWLDNKLQSEAERIIRS
DYRPKKSQLRTSSPDLSTNRVGMTTDASFLIEVSFRGPSNVVFNVTNTRPQSLPDASLAS
KVFKVPLESHV
Download sequence
Identical sequences E2BKC4
Hsal_10970--XP_391884.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]