SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_11102--XP_001119920.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_11102--XP_001119920.1_APIME
Domain Number 1 Region: 244-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000275
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 441-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000706
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 135-248
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000102
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 845-890
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000023
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 1134-1171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000249
Family EGF-type module 0.034
Further Details:      
 
Domain Number 6 Region: 665-777
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000722
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 371-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 68-172
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000628
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 9 Region: 623-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 1039-1184
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000111
Family Growth factor receptor domain 0.0073
Further Details:      
 
Weak hits

Sequence:  Hsal_11102--XP_001119920.1_APIME
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000798
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1277-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00737
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 1598-1629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 956-987
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0185
Family EGF-type module 0.072
Further Details:      
 
Domain Number - Region: 917-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0495
Family Follistatin (FS) module N-terminal domain, FS-N 0.075
Further Details:      
 
Domain Number - Region: 813-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0688
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_11102--XP_001119920.1_APIME
Sequence length 1785
Comment [mRNA] [translate_table: standard]
Sequence
MKHLWPLLTWILLSSYPAESRNGLGHGLRREVFFLNLEDGYFGCQVNESTDILQLLELSK
LCDQRVDCYQGADEQRGKLKCTNINECDDPALAGRCVENAECCNLPSNFLCKCKPGYIGD
GEVHCEDVDECTIPGACGDNTVCHNIPGNYTCTCQDGFMGDPYNNCIDINECEYEGACGK
DALCVNLPGAHKCECPLGYDGSPEEECRDINECLRSPCGRSALCTNVHGSFRCLCPDGMN
GDPWTGCHDINECEEGSPCSMNSECVNIEGSFECRCHAGYQMDPTHGCIDVNECSSTDAC
AVNARCINVPGSYKCICPPGFVGQGLTLCENVNECKRNPCGENAVCSDTIGSFVCSCKTD
YTGDPYKECSDIDECTALENPCGRNAICKNADPGYNCVCPPGYSASPNPTVACDQTDVTT
LCKSNFDCVNNAECIEGQCFCKDGFKAVGAECADLDECLTNPCGPASICTNIRGSYHCEC
ESGFVGTPPHIQCKDPCEDLSCGPNAHCMLLNDVATCLCSNGYTGKPGAKDGCRDIDECA
INPCPPGAICNNEPGSFSCQCPNGMTGDPYSGGCQESKAPHVCGPSAPCPAGEQCIKDEF
VGSSVCICQRGYTRDHETGKCRDINECMELREKSACGVNAICKNLPGSYECQCPPGFNGN
PFSLCEECNSIECQCQPPYKIVNGKCMLAGCSKGEKCPSGAECITIAGGVSYCACPKGYT
TKSDGSCEDINECTVGHQVCGYGAECINLPGAHQCTCPHGYGGDPYNGLCSPAQKRCTND
NECKANEKCVQPGECVCPPPFYTDPLEGNLCKNPCDRFPCGINARCTPSDPPRCMCEAGF
EGDPQHGCIDVNECANNPCGHGAYCINTKGDHVCECPKGMIGDPYGVGCTGVATGKSECS
SNDDCENYLACVHGSCVNPCDNIPCGPNAYCEPDKHAAWCRCVIGFTEGKNNECVSQCDG
FVCGTGAQCIVSYDGPTCKCIEGFMGNPFPGGQCVPDVCSPEIPCAEPSVCISGRCKRRC
EGVVCGIGAMCDPLTNKCVCNPYFAGNPDLLCMPPIEPPHCDPVCGKNAHCEYSLQESKC
VCNPGTSGNPYHGCGIQQKSDCSKGLCGKDAHCNAGPNAVECLCPSGFAGNPYIQCFDVN
ECNGNACGSNAVCINTIGSYDCHCKDGFFGNPFVGCQQVQVVPCVDPSSCVCNEAVPCPF
DYTCVNHRCVNQCSDIKCGPRSVCQDGTCVCPPGYSGNPNDLHKGCHLHGRCSNDLECEP
QEICFQVGKGVRKCVDACSKLQCGPNALCITQNHVSSCLCVDGYQGNPSNLVEGCQPSKS
VIPGCAHDSDCQPGSFCIVLDGGVRDCVNPCSKVICGAYQKCEPDVIPGHATCKCQDGYE
WNPVQSSCEKPSVPDCISDDDCHSSESCRPDALGVLKCLPLCSGFTCTVNSRCVAENHRG
RCECLPGYTGNPDDRRGCHSPRENRCSTDSECPEDQTCRGSLDGPLICQLVCDFVSCGPN
ALCVVNNHVANCECPPGLYAGDPNDVASGCRAVPCVYNIDCPPAQLCNRLTHTCYDACDE
NACGVNAVCIADDHRAICQCPPGLRPNPVPDVECVAVEACHSDSCHPTALCVAGPTNNPV
CKCPPNHVGDPYVNGCQPEGYCSGPKDCPVHSVCYEHRCVNPCENACGPNALCEIVNGQP
SCKCIHRFVPSSKGAEHGCVRATNFCTVDAECEDSVCLDGQCRGNDFLFWITRARIAKTD
FARCLLQTLSQKLAGRNTRIAFSEIVTVLIILIPKSAYQSFENRQ
Download sequence
Identical sequences E2BMV3
Hsal_11102--XP_001119920.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]