SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_11220--XP_001123194.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_11220--XP_001123194.1_APIME
Domain Number 1 Region: 557-749
Classification Level Classification E-value
Superfamily Sec7 domain 1.22e-71
Family Sec7 domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 67-97,131-149,321-504,806-833,1050-1400
Classification Level Classification E-value
Superfamily ARM repeat 9.68e-30
Family Plakophilin 1 helical region 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Hsal_11220--XP_001123194.1_APIME
Sequence length 1684
Comment [mRNA] [translate_table: standard]
Sequence
MFIVRALEKILADRDVKRSHLSQLRKSCESALEDLRNEIKDVPVVQGEEVTSNALPQPKS
DSNVITAEKYFLPFELACQSKSSRIVVTALDCLQKLIAYGHLTGNVPDSTEPSKLLIVRI
VETICGCFTGPQTDEGVQLQIIKALLTVMTSQHVEVHEGTVLLTIRTVYNVYLASRNLVN
QTTARATLTQMINVIFARMESQAEEESVKIDGESQQEAAAGTVVANGETEAELNTENGDV
TDPQTIVRGILDDVVNSVVPLEEEVSLENGPEDNGDEATAENDNMVTAKFTHVLQKDAFL
VFRALCKLSMKPLPDGTPDPRSHELRSKILSLQLLLGILQNAGPVLRSNEMFVIAIKQYL
CVALSKNGVSSVPEVFELSLALFLALLARFKVHLKMQIEVFFKEIFMNILETSSSSFEHK
WMVIHALTRICADAQSVVDIYVNYDCDLSAANLFERLVNDLSKIAQGRQALELGASPNQE
KSMRIRGLECLVSILKCMVEWSRDLYVNPSVPADQQPLSDPPDPAPETPLPRYGSAGSLS
SANSSLTGNKEVPDSPEQYEVQKQQKEVWEAGIEIFSRKPGKGVQYLQEQGLLGTSPEDV
ARWLHLDERLDKTAIGDFLGDHNHNQVMYHYIDQMNFAERDLVTALRYFLEGFRLPGEAQ
KIDRLMEKFASRYCECNPNNGLFTSADTAYVLGFSIIMLTTDLHSPQVKNKMTKEQYIRL
NRRISDNEDLPEEYLSRIYDEIAGNEIKMKSNPNNSRLAGKQLISSEKKRRLLWNMEMEV
ISTAAKNLMESVSHVQAPFTTAKHLEHVRPMFKMAWTPFLAAFSVGLQDCDDPEIASLCL
DGIRCAIRIACIFHMSLERDAYVQALARFTLLTANSPITEMKAKNIDTIKTLITVAHTDG
NYLGGSWLDVVKCISQLELAQLIGTGVRPQLLGPPSKPHFPSPLANFGNLTHSVGSHQAN
SLNLSSLDPSVKESIGETSSQSVVVAVDRIFTGSTRLDGDAIVEFVKALCQVSLEELAHP
TQPRMFSLTKIVEISYYNMGRIRLQWSRIWQVLGDHFDRVGCSPRQDIAFFAVDSLRQLA
TKFIEKGEFANFRFQKDFLRPFEHIMKKNRSPVIRDMVVRCVAQIVHSQAPNIRSGWKNI
FSVFHHAASDRDESVVELAFSMTGKIINELYAEDFSIMVDSFQDAVKCLSEFACNASFPD
TSMEAIRLIRSCASYIDANPNLFAEGMMDDSGMVSEEDRAWVRGWFPLLFELSCVVSRCK
LDVRTRALTVLFDVVKTHGASFKPHWWKDLFQVLFRIFDNMKLPEQHTEKAEWMTTTCNH
ALYAIVDVFSQFYDVLGPLLLEQLYSQLLWCVQQDNEQLARSGTNCLENLVISNGIKFDE
QTWEKTCQCVLDIFESTLPSALLTWKPQSPNKESDLDVITGEADGYHVGILKRSNSTQSL
NSESLSKTKLFSALLIKCVVQLELIQTIDNIVFYPATSRKEDQENLALAQADMLNGKTSE
LVKAGADQQKEEQGMYCALTTSHLLQLVECLLRSHRFAKSFNSDHEQRNVLWKAGFRGNV
KPNLLKQETQSLACALRILFKMYSDEVHRADWPKVEARLVEVACEALEYFLAIANEAHRD
AWTPILLLLLTRILKMSDHRFAVHASTCYPSLCEVMCFDLKPELRSVLRRFFLRIGPVFR
ITQQ
Download sequence
Identical sequences E2BRU7
Hsal_11220--XP_001123194.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]