SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_12613--XP_393442.3_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_12613--XP_393442.3_APIME
Domain Number 1 Region: 1231-1376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.49e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 1384-1429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000489
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 280-415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 4 Region: 943-1072
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000165
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 181-325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000832
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 744-862
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000119
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 1195-1239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000202
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 8 Region: 1065-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000047
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 9 Region: 849-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000662
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 605-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 11 Region: 507-548,595-690
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000157
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 12 Region: 1417-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000802
Family EGF-type module 0.0064
Further Details:      
 
Weak hits

Sequence:  Hsal_12613--XP_393442.3_APIME
Domain Number - Region: 446-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000435
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 402-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_12613--XP_393442.3_APIME
Sequence length 1596
Comment [mRNA] [translate_table: standard]
Sequence
MARYVGLSESFIVLLLVVHLEQLILHNRVDCGRDEFYENLESDQQSGVASVVEGVIEDRF
EKCCGLGTSWAEEGLRCERFIGPVPGVPTVEQGPCQKAVDICCVRKYHDLQCEKGKADAR
QGLPCVSNVTSARRTKITSRGDYHRDCCEGCKLGIYAASTDQGCGFKSFSFGIPWDPAFL
ECCHENLPSMLCSDICVPTPGSYYCKCRDGFTLLEDGKTCSQDPTDRCKSTHPCEQICTD
NGEAVICSCNPGYDLADDGRSCIPKTTKNKKSTDAADKDNASSLLCPSGYRYNVTKQVCD
DVDECLEWSMCPGRCQNTIGSFVCIPMKSIKDAPYEACPPGYQWEPRAGVCTDIDECSVL
LNACTAAKPFCVNTQGSYACLEMTGAKSCPAGFKYDKLSQQCKDVDECAEAIHSCLTDVE
ECRNTEGAYECDMKCEKGFTYSISLGICVDVDECVESSNLCPEPDTLCVNTVGAYECVRS
SGDSLPRLPIEKDLFERQKKPLSPLICSAGYKPANDSEITCIDVDECSEQLHSCEPDERC
VNEIGSYRCVPVKHDEGVSTTKKSGDGRRDDRYNGGYKLDETSTSPVTNRNNEVEHCDNG
YFFDGKSRRCIDVDECANGLAICGIGERCVNTEGSYRCSPTCTTGFRLRLNLVNDTEDPC
EDINECSLGLHNCNRLTHRCLNTNGSYLCEPLTITTTTTTTTTTTTPSSTTRRTFNDSRY
KIAQTSRSRDLLNNKADRYWSTEPCRLGYKREASTGYCVDIDECLVGPGCRDYERCTNIP
GAYDCSPLCSTGWFFNTATKSCQDVDECLLGRHDCSQGTHRCVNTNGSFVCELIPPCKPG
FRRAFNGACLDVDECSESLHNCRLDLHQYCVNKEGSFECLTRLPSCSAGYQYSLGTRQCE
DIDECLTGKYNCDMRFLERCINLPGTYRCQRPLPAVQRPRQRPACPSGYRYHNLLRSCTD
VDECAEGLDTCGDEICYNQPGGYSCATPPAPITRKPSTTALPAPGNNQRCMDGTRLMRNR
GCVDINECKELEDACSSNEECVNTMGSYTCTCKTGFRRDNLTQACVDINECQLQQNDCLS
TQRCDNTIGSYTCTRFLPCGTGYTLNAATEICEDDDECALGTHDCSGGYQCRNTLGSYRC
DRIPRIPTPQPRTLPISRATMMTTTTTTTTTTTAPTSLTPAISWPSCPRGFESGSGGKCV
DIDECRRTPNPCGRQNCVNTLGSFRCVSRVICPPGYALDPVSGQHCLDIDECREGSHECA
KGQVCENRPGGYHCLCPPGYVDGPNNDCVDIDECSVYGARICGLNSRCENTAGSFRCLCE
EGFENNRGAGLCQDIDECERIPGLCQHVCLNVWGSYQCRCNSGFRLNADNRSCSDIDECM
EFKDNNLCIGICENTPGSYACKCPDGYRLGSDGRTCQDIDECATGQVCRNPDETCHNTRG
SYRCNRINCPAGYHRDSAKKNRCVRSLRSCPWGDLACIRSPLHYSYNFITFVSMLPIPST
GQLELFTMRGNHHPDSTIQFTMALMDVRAAPGVARATESCFSLRKPSLSQAVLVMTRSIP
GPQEIELDLSMEIYHESKFVGSAVAKIIIFVSQYEF
Download sequence
Identical sequences E2BUT1
Hsal_12613--XP_393442.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]