SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Hsal_13519--XP_624587.2_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_13519--XP_624587.2_APIME
Domain Number 1 Region: 827-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000103
Family Laminin-type module 0.00082
Further Details:      
 
Domain Number 2 Region: 727-778
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000106
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 3 Region: 938-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 4 Region: 281-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family EGF-type module 0.087
Further Details:      
 
Domain Number 5 Region: 444-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 6 Region: 883-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.0037
Further Details:      
 
Domain Number 7 Region: 341-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000271
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 8 Region: 397-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 9 Region: 986-1032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 10 Region: 788-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.0092
Further Details:      
 
Weak hits

Sequence:  Hsal_13519--XP_624587.2_APIME
Domain Number - Region: 1115-1136,1198-1420
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000123
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.006
Further Details:      
 
Domain Number - Region: 689-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family EGF-type module 0.082
Further Details:      
 
Domain Number - Region: 96-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00969
Family CBM4/9 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Hsal_13519--XP_624587.2_APIME
Sequence length 1646
Comment [mRNA] [translate_table: standard]
Sequence
MRVTKVFLLLLLVGSYALASPEPSDELYSRFQPRTRKEDKCYDENGKPQRCIPPFENAAF
NVPMEATNTCGEDHPTEFCKQTRVQKKSCEMCQWGDHSAIYLTDHDNNDNATWWQSSTMY
EGIEYPNQVNLTLHLGKTFDITYVRVLFESPRPESWGIYKRKNEKSPWEPYQFYSATCRD
TYDLPESKETVRGDDTRVLCTSDFSDISPLTKGTVAFSTLEGRPSAYYFDTNPELQEWVQ
ATDLRITLDRLNTFGDEVFGDSHVLKSYYYAIADVAVGARCACNGHAGECVNSTSVDGRT
RRVCRCEHNTAGPDCNECLPFYNDAPWGRATTTDAHECKPCNCNGYSDRCYFDKELYKLA
GHGGHCLDCQANRDGANCERCRENYYQRPDDNYCIACHCNEIGSRSLQCNSEGKCQCKPG
VTGDKCDRCAPNFYNFGSLGCTSCECSFAGSEGNSPSCDPVTGVCVCKENVEGKRCRECR
PGFFNLAEENEFGCTPCFCYGHSAVCRSAAGYSKLVIESMFVRGNERWSAMVVGNQIPVQ
YDALTQTISVTAASRDSVYFLAPDRFLGDQRASYNQNLSFSLRIGETGPAVTVRDVILEG
ANGGQITQTIFGQNNRLPTVKRQEYRFKLHEHLSYGWQPQLSSRAFMSILSNLTAIKIRA
TYTNQGRGFLDDVKLETAHRGAAGEPADWVEHCQCPHGYVGQFCESCAPGFHHDPPNSGP
FALCVSCNCNGHADICEAETGQCICHHNTAGDNCELCARGFYGHPLRGTPNDCQPCPCPD
NGPCILLGSNPDPICSECPIGRTGPRCETCSDGYYGNPERGLACRPCDCNNNIDLNAVRN
CNHETGECLKCVNNTAGFHCDECLPGYYGDALSDRKEDGCKLCQCYPPGTVELDDGRVMP
CDQLTGHCTCKPNVVGRNCDRCEEGYYHIMSGEGCTPCNCDLEGSYNRTCDPITGQCQCR
LGVTGQHCDACEPYQYGFSREGCKPCDCDSIGSQDLQCDASGQCPCLTNVEGRRCDRCKE
NKHNRQNGCVDCPDCYNLVQSAVDDHRRRLAELEDTLRKINSSPTVINDSDFEKELKNVQ
DRVRALLNVAKQGSGSENKTLVEQLDELRDQLNAIDEIYQTVNVTANDARDIIEDGLVNI
DEAEKVLDKTYEHLTLGENFLNIDRREKSQCNYLFWLIVRIQKEAEDYLATDGASALTDA
KLRAEQVGQQNQQMTAIAQEARLLAEVNTNEAKKLHMLAEQARNTTLEAYNLAKQAISKY
SNITDEIRGLENKLAQLDDRMNEVKNLTAVAANKSSTVSQEAIDLLILDLTLPHVDIKQL
WEQVESVNNEGVKIKEQAQLLLEENENLINEMTEKARKSHELLERAQDQQAATAELLAEL
DQANETANDAVNRGDQTLKEAQETLKKLGEFDAEVQRERVKAQDALKDIQSIKELIDIAT
TQTREVERALNGSEDNAKNAREIAQNAQTYADKASVNANDIRMEANKTKIEALRLGNEAE
KLHQRVDITDTMMRQYEIQVVKDSNIATEANHKVGQAKINVTQATHLVDKALSEVAEIIK
ELENLPEIDDADLNRLEERLVAAEKEIKAANLDQRIRTLTDAKNTQTQWVKNFESEVNRL
RIEVENIDDIRKVLPVDCYQRVRLEP
Download sequence
Identical sequences E2BNR1
Hsal_13519--XP_624587.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]