SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPPG_02085T0 from Spizellomyces punctatus DAOM BR117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPPG_02085T0
Domain Number 1 Region: 4-291
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.14e-105
Family Inorganic pyrophosphatase 0.00000000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPPG_02085T0
Sequence length 297
Comment | SPPG_02085 | Spizellomyces punctatus DAOM BR117 inorganic pyrophosphatase (298 aa)
Sequence
MTEYKPRVVGAPNTLEHRVYIEDSTGKVVSPFHDIPLYANAEKTIYNMVVEIPRWTNAKL
EISKDEAFNPIKQDVKKGKLRYVRNCFPHHGYIWNYGAFPQTWEDPTSVHPDTKAKGDND
PLDVCEIGETVGYTGQVKQVKVLGTMALLDEGETDWKVIVIDVNDPLAPKLNDIEDVEKL
LPGLLRATNEWFRIYKIPDGKPENNFAFSGEAKNKKYATEVINETHEAWHRLITKAVPNK
GESYDVTTVNTTVADSPYKVGTDSAEYKSVPASAPKPPGPIDPSIDKWFFISGQPNL
Download sequence
Identical sequences A0A0L0HQC6
XP_016611053.1.7107 SPPG_02085T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]