SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPPG_01491T0 from Spizellomyces punctatus DAOM BR117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPPG_01491T0
Domain Number 1 Region: 904-1094
Classification Level Classification E-value
Superfamily Sec7 domain 5.49e-72
Family Sec7 domain 0.00000311
Further Details:      
 
Domain Number 2 Region: 567-691,735-768,1314-1382,1435-1552,1581-1603,1664-1718
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000151
Family HspBP1 domain 0.074
Further Details:      
 
Weak hits

Sequence:  SPPG_01491T0
Domain Number - Region: 100-124,209-297,557-654
Classification Level Classification E-value
Superfamily ARM repeat 0.0374
Family GUN4-associated domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPPG_01491T0
Sequence length 2208
Comment | SPPG_01491 | Spizellomyces punctatus DAOM BR117 brefeldin A-inhibited guanine nucleotide-exchange protein 2 (2209 aa)
Sequence
MSRARRVTSQASRSFGAGAVQLSLAENGDSMSGVGMIKSCLDRLLAESARHKDLRDAVEA
ALVQLEEEKQGGEDVAKTISADRYWNPFKIACHNTQPARTREVALDCLQKLIAHNLLRGA
LPLTVSNTPTAASSTAPGTPGAPANDLSQLDTSSPATSPQPLDEKGTEEQDEENGTQQVA
KTAVPVFAPRSTSLLPSTPAEAPNYPPIPFLIDEIIHTVCTTLAMHTDEAVQLQVLKVLL
TAVTSTGCEVHEVSLLKVVQTCFNIHLHSRTQVNQMTAKASLTQMINLIFSRMERYAEVL
AKSLETGSMGEIEKLTGLSAMGAESLNQYRTNVKARAINGTSDAEEPTDTSKDPEPDGEV
GEKSSKVESEILGVESQAENDLESKLPQIEVGSLAVELQTAGELADKPLDKDAADPPDGC
EHEENENVPDASAADVASTAGDAAAAVVQGTETATPDHENATSIRGAAADEASDQSSLQS
HMTMGSNQQQPEQSIEVGSTLTPANPVTGNNPYDPTIAYYNELLRKDVFLVFRLLCRLSL
TSDSSQNTMATFSAANVKEAASMPMDELSHQSTKARQLALELIMSVMNNCGPVFQSDDLY
TGLVRHNLCLSISRNGITTNPTLFELSLSIFLMVTRFYRSKLKTEIEVLLNTIYLHILEM
GNSTYNQKRMVLQGLLKICENPQTLADMYLNYDCDIAMVSIFERIVNVCSRVAQGRDSNA
PPAPTGLMGLAASAAGLDTKEQLLKAQERRLKLRGLCCLVALVTSLTEWSKDVAPNLPLS
TTRRRRSGDLPRVSIASNRDASENTARMSVSDDRRDNKSSPTQRKSTDGTKPASAGSDNP
TKSFLDALAPTNQVNPVLVYKHPLHSVSMDHVPYMFPNNSTTSLQSVTTVTPDEDSSQIE
TVASRKQLLRNDIRQFNMKPKAGIKALIEDGFVEEDAESVARFLRTTDGLTKAAIGEYLG
EGHPFNIDVMHVFIDNMDFTNIDFVPALRSFLQTFRLPGEAQKIDRIMEKFADRYYENNP
DVFAKADTAYTLAFSVIMLNTDQHSAEIKHRMDKNAFIKNNRGINDEGDLPEEYLAAIFD
EVSNNEIVLEEEQAGKLAQMAIGWGAGDLNDRQRMELYRKEIQMVQKKSQQLIQNANRTV
APFRTAVNADLARPMFGMASWPLMAVFSLAFEAANDEEDVDDAAEGPRSLEPKAADLCLE
GFAGSIRLASIFRMETERDAFVTSLSKLTGLSHIQDIRPKNIKAIKTLIMIANVLGEYLE
SSWMQVLKAISQLERLQLIANRGSFDNATRQSGDAVHAGDEATAADLPYGGSAAPVRQSA
YRTIEDLTSNSRPNPAVEKLIAEFHNQATVVAVDRIFTNTLKLSATAIIHFFRCLCHVSM
EEVGLDPSAPVGGMPQVLHSGAPRMYLLQKIVEIAYYNMPRIRFEWTQIWRILQPYFNTV
ACHPNTTVSTFAVDSLRQLSMKFLEREELGHYSAQNEFLKSFEWIMKHNANPAIRELILS
SMAHMIAARARSIRSGWRSIFVVLAKAAQSSSGDEKMIKTAFGIVQVVFREHFDAVNHAG
GFVDYVACLAEFALLEGSGQTYDEVVMGSIQLLQSCANYLVKHGSETLEGKPRRSSQGEL
DGQKPVPPAVLLNGTALSVPPTPTSTHPPRAPSQPYLQANGMVSEEHFFLKWFPILSAFS
RVVIDSESVTVRTRTIDALFDTLKSAGQRFDVKYWKNIQRSVILPIFADLGERTDSVSQE
QYRPRGKEADTAIWVHGLRLYADLTTSFFEKLATAGHAELMKGVLDLLIGMLQRRDEKLA
TTGGICLHGFVRDNLGRIGKCGSWGVITDGVEKAFATTLPAELLCCDYGKVSSKPLDANS
NRTESVGSEVVSAGYTAARAVGTEVTLDTLDFEHTLVKCVTHLELVQALRDIAFTKLVGS
GRRGSEAKVYVDKTQSGRNSIVADMTATERPVDKSDPGSTPVPPVVPEQKQVLAINIIPP
EFRHRWLKCLYDSYAVARAFNEENDLRYAIYRRGLVPQLPHLVKQETLSFATYLRMLFAV
YRAQSSSTPFPREPKSPSTETISMETAGQGDASVLPELVKHTLDVLGRYVECLNDQQRNQ
LHIGLWSPVVAMVFKELLGMEGLWTAQAANGEPSGKCAEAREHSDGSVHELGTAAHNGIS
NGPQHHVELKQHVPRYFKFAVKMMGVDRPEVRTALQEFMERVGDEYIR
Download sequence
Identical sequences A0A0L0HT24
XP_016612084.1.7107 SPPG_01491T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]