SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPPG_03863T0 from Spizellomyces punctatus DAOM BR117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPPG_03863T0
Domain Number 1 Region: 694-887
Classification Level Classification E-value
Superfamily Sec7 domain 4.32e-74
Family Sec7 domain 0.00000349
Further Details:      
 
Domain Number 2 Region: 24-94,168-231,453-524,1147-1402,1430-1595,1645-1675
Classification Level Classification E-value
Superfamily ARM repeat 8.23e-16
Family Armadillo repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPPG_03863T0
Sequence length 2005
Comment | SPPG_03863 | Spizellomyces punctatus DAOM BR117 protein transporter sec72 (2006 aa)
Sequence
MSGSNSPAPNLQQGSSDVFIKLALEQMQSAKEAKKLNNLRDASKSALEALESPSSHPAMD
AQTIQTIFAPFQIACRSRQATLATIAIDCLGKLFTYNYWGRHDALLEGDAAVGGSVADFD
MDVPRKEPGSNRLSGDDDRSSMESNAEGGGSMVALVVDTICDTFGGGENTDEKVQLQIVK
ALLAAVSNADPTAAIHGGVLLKAVRTTYNIFLLSKSANTQIVAQATLTQMVQAVFGRVPK
DIPKADDDKTRSRSSTAAPDGKVEQIPTQGASADSTEQDASPTESESPAMEDGGSKGDES
PSRASGGVASVDDDRASVASSGMRGSASVDSISSTGLDEERRSQDILNESSKKVKGSAAE
QYIKDAYLVFRALCKLSMKPIPAPEGATDLKSHAMRSKLLSLHLVYTILGSHMYIFFTPA
PVLFSPGTQTKADSNAVLFVHAVKQYLCLSLSRNAVSVVPQVFDISMEIFGKVLIGLRSV
LKKELSVIFTEIIIPIVEARSSITFHQRTSLLKALQRILSDPQADGGRVLVEIYLNYDCD
VEAGARENIWERLVNALAKVMTQHHETSTTVPATGPAQQQQQQSQRGNTMPPAITTANLT
NFTKEQVRELYSSTGDYGELKKRGLELMVRGVLRPLVAWCNARAPAAGAPAEEEKGGRKS
EEAEASVKLGLVTDEEGKKGTGQQPGRKIEDDPTAFETLKHRKQVLSEGIKRFNFKPKKG
MQYLLDSGCIASRTPRDIARFLLHTDGLNKSMIGEFLGEGEEENIAIMHAFVDEMEFSGM
TFTDALRLFLQCFRLPGEAQKIDRFMLKFAERYVKGNPQNFSSADTAYVLAYSVIMLNTD
QHNAQVKKRMTKADFLKNNRGIDNGQDLAQEFLEAIFDEISQNEIVMKDEQPVVPGVSPG
GPNDKPGVSGSGSNKKEVAHFALASETMALKTEAIFNTMLKGKSKRTATIPGGASKEAAP
AGGFFVASHYEHVKAMFQIIWMSILTGISGPLQESEDVETIIVALEGFKHATHISCLFDM
DLEKKAFISTLSKFTMLGNMQEMRAKNFEATKSLLEIAFTEGNFLGENWKDVVLCVSQLE
RLQVVGSGNESDAARPRASTDRLQRRESSNAITRTGFLQEAAAEAGSQGMTVMVDRIFTS
SVKLSGYAIVAFVRALCEVSWDEITFSSDREHPRMYCLQRLVEISYYNMKRIRVEWSNIW
AILGDHFNQVGCHPNSNVGFFALDKLRQLAMKFLELEELPNFKFQKDFLRPFEHVLGNNS
DVKIKDMVLACLQQMIQAKSKSIKSGWKAMFGAFIRAARETHEPIVLLAFDIVKGIFKNN
FESVVANQTFPDSVSCLVEFCKNRKFGRTSLQSVEILRQSIPRIYELSKTQQGSKLLINA
VSSMAVLRSNENLTESIQQSLLASTPGSATPGTAGPIKPAGIPVGGGVAPEDDPSFRFWF
PILFGLYEVIMTCDLEVRTRALNYLFDTLKQYGASFSRDFWEVISKGVLFPIFDDLRLSR
QEHTKFANREDMSVWLSTTLIQALRQFIDLFGHYFDTLNFQIDGVLELLTVCMTQENETL
ARIGSTCLQQFIEGNVQKLDDAVWEKVCTMFVHLFEVTTPHALFFDPNDSGDGPAGGEES
TPIIQTPDGSGLVIDTRPRRPRPQRSEFQQIIVKCVLHLLVIQTLQEVLTSGPEDAVYQS
LSSKNLFTLIDCLERSYRFARAFNGDMDLRMALYRMGFMRQLPNLLKQETSSVSSYLGVL
IKMYLDVSAERRGMRGEIEKRLVPLSHDILMHYNSLDPESKRRNVNAWRPVVVTILNALV
DFDEDQFRRQMPLFYGEVVNLLIQDVTPDVRLVLHSLLIRTGTTFGIMTEREALSATASR
SSVAGSTEGIHSIPVSPRGSQRNLVAGGGDDLVSEGGGIDSAPIDSGLPDLATCDAPIDM
GEGEVSTHEGGWMISREETGSPAVPPNIGASANENAAEGEQAEVNDLRADSFSGESTEIP
SSATEGVEDKTRQGGTGLTDDETFT
Download sequence
Identical sequences SPPG_03863T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]