SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPPG_04499T0 from Spizellomyces punctatus DAOM BR117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPPG_04499T0
Domain Number 1 Region: 6-138
Classification Level Classification E-value
Superfamily Cap-Gly domain 9.29e-26
Family Cap-Gly domain 0.0014
Further Details:      
 
Domain Number 2 Region: 153-370
Classification Level Classification E-value
Superfamily L domain-like 4.08e-25
Family Ngr ectodomain-like 0.053
Further Details:      
 
Domain Number 3 Region: 430-508
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000792
Family Ubiquitin-related 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPPG_04499T0
Sequence length 509
Comment | SPPG_04499 | Spizellomyces punctatus DAOM BR117 predicted protein (510 aa)
Sequence
MTLNAHSDKLRQRICVSNHFGTIRYHGPVPLGSNTLWYGIEWDDPSRGKHSGAHDGTQYF
HTRVPNSGSFLRVSKVPTDAFARSFLEAFQEKYLSLQPQDGIVRFGGNGVDVETVGWDKI
SRKLAQAGNIREVGLAGMRVGFRGGKDGQVRELCPAIVDLDLSRSLFQTWKDVADICREL
ADLQSLRLAFNRMQPLEDTAHGELKDVFNNLRALTLIETLLPWEELQKLETYLPQLKELH
LGFNHLASFPLINGFQNIQFLNLEHNDFTSWAEIRKLALLPSLRTLMINNNYLASIEAPA
AGEFAELTTLNISNNKIKSWTSIHALNSFPALVELRLRRNPVLDDVPSSDLHPFLIARLA
KLTTLNGSTLTPRERSDSELYYLGRCAKELSASSDPTSFHLLHPRYEELARIHGAPTPAP
VTATSSILKDRLSTITLCYESKKIRKKIPNTMNIRALKVLASRILGVKGSVHLRKVGKLG
APNIEMEDDLRDVHFYDVENDDEIVVYVD
Download sequence
Identical sequences A0A0L0HGE7
XP_016608197.1.7107 SPPG_04499T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]