SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPPG_05921T0 from Spizellomyces punctatus DAOM BR117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPPG_05921T0
Domain Number 1 Region: 859-1055
Classification Level Classification E-value
Superfamily Sec7 domain 4.71e-66
Family Sec7 domain 0.00000998
Further Details:      
 
Domain Number 2 Region: 1409-1560,1610-1840
Classification Level Classification E-value
Superfamily ARM repeat 0.00000648
Family Clathrin adaptor core protein 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPPG_05921T0
Sequence length 1902
Comment | SPPG_05921 | Spizellomyces punctatus DAOM BR117 GBF1 protein (1903 aa)
Sequence
MDFRNEQIAVSSVLPANVGGVHVGDGRSVFPRPKHARPESHWIYIVQAEIVSVTAAMRKN
QRWSIHADRVRREDMPSVVPYDFCQDVVAHGRAHLDALVDFTRGLGPADWGVGGVEENPL
LQGFARLRARLMLLNELRDLDPSHLLEPFLEVIRSGDTTGPITGAALSSVEKFITYRVLD
PNHPGLPSAMAALTHSVTRCKFEATDAVSDEAVLAKILGLLRVIIQSEAGQKSLDDKGIC
EMVEVAFGMFFQGRITELLRRSAEQTLIMLVQALFERLTVLVRAKEHEDNRSVFGPTSIG
IPIEKGGARLRGSVVATPQLYPTRRPSAADHKGVSDEDHAESGGISPSISVFEQGSEGHR
SADLNMISVGGSQASTLDHGQTEFLKDDGPRITFASNDYILPDGGVKTVRQDLARHHTLE
DGHHLSNVEEPHVSDRDPGIDAGDPPAHTSSSGGNVIAEETPSTPVHHVFQPFGLPAIIE
MLRVLVTLLDPRNKQHTDSMHRTMALTLLHAGLEVGGCSLGKLVSWGFLDEKTSPLRRTP
QTRAPAKVTRSATLSQSSALSQEQESASSDPRQSPERTNAYVSIVQDGANVDSRDVSSSR
RTSLGSAEGSLYQSEVEAGIPEDGEERAPYLAKDLVVNELCKYLFQLLQNSAYTSTQSPS
VTTLTILALTLKCITTLFQSSRQHMKLQLEWFLEWTMGRLDGGVVTLDIEDWAKKETHSK
EPWQRASAAGAQQRGGVIVGEARELMLESMAQLCRIPGIMVELYVNYDGDMDRRSHLFEE
LVTFFAKHSFPDVTPGGPISTTAHQTLCFDALLMVLNDIMERKSHNGEFMTPSLGESPEG
YQTSSEAPCTDRQLPPPDSVRFNKARKRVLKEGTDRFNDNPKEGLKFLQAHNFLPDPLDA
ESLARFLKTTASVNKKLLGEYLSKPKHVDVLKAFVGLYDFGDKRFDEALRLLLESFRLPG
ESQQIERIMQNFASAYFDAIKGKENHDIETVDATFILAYSVIMLNTDQHNPQVRRRMTLD
DFMRNLRGLNGNKDFSPEFLKQMYTAIRENEIVMPEEHEGDLGFNYQWKELMKKAEHAGD
VLTCRTNCYDKDMLRTVSDSILSALSYAFDNAEDQLTLQKAVIGYHNCAVVAAHYRLTEL
YDSLIISLAKMTGMLKETSRLPPDTTMEDTNNDRNARRPIDPWRVEIGRNYRGQVAAVLM
FTLVSEYGTCLKSGWRWIIGCLRNLFLHSLLPASMVQVEDFVRGSVVISRLRDQDVTSRK
PNAPGSRREAGLLSTLSNFLSLSSSNGDDFDNYEATPDGVEYEKRAIHCVRSCRIEQLFA
DSRFLEEDTLRLLVEIISQASFVQENRDPEHSTWRRRELEEGQDVSPDGSDARAERSEAV
TAPLPSDQAARKYDSAAVFLLELLIAITIQNRDRIMTLWPLVLEHISGILKSSGDCHPVL
VERGVTSLLRLVQRLGHKDDMLERILQSLDLVNSLSPEAFNRVAEPLMAGIAFLLKSDPS
LVTRNARWEVVIGFLSRTSVHPEASRFSFEATCILVSENADSCVSSHNFSECVDLLISFA
AAAGGIVLSSAVASPSGRSTGLIGGESVNLSSSAPTSPRLGSRERLTPVKSQLTQVAIER
ALRALDKLFKLHLKIPSLVEETGMKFNRAFFEFWLPVLSGLSQQSYHPAREVRQHALTLL
QRTLLSPELETGCGPGSPSVWADSFETVLFPMLDELLRPEMTRIDPLGMDETRMRASALL
CKIFLQYLPRLQNWKELPQLWIKILDYMRKQMSMGESDYLYEGVQESLKNMLLVMSTQGV
FQPSAEVTLAAGESQNLWELTWKYVDSFLPDLKDELFPPPSESMVNEVDQPTSTSATDAL
ASIAAHALALAGPTESPEPQPKPVPVKEVPVEGGSVIMQEDS
Download sequence
Identical sequences A0A0L0HBI9
XP_016607005.1.7107 SPPG_05921T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]